DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arm and ankar

DIOPT Version :9

Sequence 1:NP_001259149.1 Gene:arm / 31151 FlyBaseID:FBgn0000117 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_001035135.2 Gene:ankar / 368636 ZFINID:ZDB-GENE-030616-533 Length:1400 Species:Danio rerio


Alignment Length:762 Identity:155/762 - (20%)
Similarity:269/762 - (35%) Gaps:243/762 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 QRLSEPSQMLKHAVVNLINYQDDAELATRAIPELIKLLNDEDQVVVSQA-AMMVHQLSKKEASRH 194
            :|:.:....|:...||..::.:|. |....:|.|:.||..:.|||...| |::.|.....:....
Zfish   714 KRMEKTLGCLEALCVNTESFSEDI-LDAGGVPVLVSLLCSDRQVVQCMATAVLCHMTENSQVCEE 777

  Fly   195 AIMNSPQMVAALVRAIS-NSNDLESTKAAVGTLHNLSHH---RQGLLAIFKSGGIPALVKLLSSP 255
            .:.:.  .|..|::.:| :..:|:|..|.:  |.:|:.|   .|.|:|  ..||:..:|.||:|.
Zfish   778 LVHHG--AVPILIKLLSVHQPELDSRCAVI--LADLAAHSKQHQSLIA--DLGGVALVVNLLTSD 836

  Fly   256 VESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVKFLAIVTDCLQ--------IL 312
            ::.||...:..:..|.:....::.||..|||:..:        ::.||:.:|.||        .|
Zfish   837 LQDVLVNGVRCIRTLCVRSPHNQTAVAHAGGVPHL--------IQILAVDSDTLQEEACLALAEL 893

  Fly   313 AYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVDAGGMQALAMH 377
            :.|::|::.:|..:|....||:.:|.              :.:||      .:..|..:::||.|
Zfish   894 SRGHRENQALICEAGAVGALVQALRH--------------RKISV------KVKAASALESLASH 938

  Fly   378 --------LGNMSPRLVQN---------------CLWTL--RNLSDAATKVE--GLEALLQSLVQ 415
                    |...:|:.:..               .||.|  ::|:......|  |...:|..|:.
Zfish   939 NSAIQQCFLRQSAPKYLLQLLTVFQLDVREQGAIALWALAGQSLNQQKLMAEQMGYSVILDLLLS 1003

  Fly   416 VLGSTDVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVR-------------TIINA----- 462
              .|..:..|.|.|.|.  |:.:::.::...|:..||..|||             ::|.|     
Zfish  1004 --PSDKIQYVGCRAVIA--LSRDSRIHQNGFCRENGVPPLVRLLRGSRTGQKTLLSVIEALGCLC 1064

  Fly   463 ----------GDREEITEPAVCALRHLTSRHVDSEL-AQNAVRL------------------NYG 498
                      ..:....|.|:..|..|...|...|: .|.|..|                  ::.
Zfish  1065 IGVALTTNKNSQKTVYREQAIPTLLELLKAHKSQEIKVQVAQTLACVLLGNQKLQREFWEQEDFS 1129

  Fly   499 LSVIVKLLHPPSRWPLIKAVIGLIRNLALCPANHA-------------PLREHGAI-HHLVRLLM 549
            ...||:||:..:            :|::| .|.||             .:|:.|.| ..:....:
Zfish  1130 YENIVELLNAEN------------KNISL-DAGHALSLFAYNSKAHQKAIRQLGGIPGKIYETFL 1181

  Fly   550 RAFQDTERQRSSIAT-------TGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQQS 607
            .:..:||:.:::..|       :||.:.:..|.||                              
Zfish  1182 NSDNETEKAKAAFQTVVLARVISGSDEVTLTARGV------------------------------ 1216

  Fly   608 VIPIFVRLLFNEIENIQRVAAGVLCELAADKEG-AEIIEQEGATGPLTDLLHSRNEGVAT----- 666
              .|.|.||.::......:.|.:|..||..:.| .:.|...|||..|:..|.|.:|.|.|     
Zfish  1217 --TILVELLQSDQSTTVIITAQLLASLAHMRAGITDAIVSMGATEHLSAHLDSEDEEVRTACTSA 1279

  Fly   667 --------YAAAVLFRMSEDKPQDY---------KKRLSIELTNSLLREDNNIWANADLGM--GP 712
                    ||...|.......|..|         ..|:|...|....|:....:.:..||:  ||
Zfish  1280 LGYLTFNRYAHRQLMTKCRKSPHIYDLLMKNLAPDARISQLFTAEFERQRRIGFPSLSLGINGGP 1344

  Fly   713 DL-----------------QDMLGPEEAYEGLYGQGPPSVHSSHGGR 742
            .:                 |..:|..|.       ..||||  |.|:
Zfish  1345 PVSPGNNKGPSKKLNTRGSQSAVGERET-------SAPSVH--HVGQ 1382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
armNP_001259149.1 Adaptin_N <150..>314 CDD:331138 44/176 (25%)
armadillo repeat 161..186 CDD:293788 10/25 (40%)
armadillo repeat 193..231 CDD:293788 8/38 (21%)
armadillo repeat 238..270 CDD:293788 9/31 (29%)
armadillo repeat 278..314 CDD:293788 11/43 (26%)
armadillo repeat 320..355 CDD:293788 5/34 (15%)
Arm 361..398 CDD:278915 10/61 (16%)
armadillo repeat 362..397 CDD:293788 9/59 (15%)
armadillo repeat 410..435 CDD:293788 7/24 (29%)
Arm 439..481 CDD:278915 12/69 (17%)
armadillo repeat 443..481 CDD:293788 12/65 (18%)
armadillo repeat 490..525 CDD:293788 7/52 (13%)
Arm 597..636 CDD:278915 7/38 (18%)
armadillo repeat 600..636 CDD:293788 7/35 (20%)
armadillo repeat 641..675 CDD:293788 13/46 (28%)
ankarNP_001035135.2 ANK 489..621 CDD:238125
Ank_2 489..599 CDD:289560
ANK repeat 520..550 CDD:293786
ANK 569..691 CDD:238125
ANK repeat 569..599 CDD:293786
Ank_2 574..663 CDD:289560
ANK repeat 601..630 CDD:293786
ANK repeat 632..662 CDD:293786
Ank_4 638..691 CDD:290365
armadillo repeat 702..726 CDD:293788 2/11 (18%)
ARM 735..852 CDD:237987 32/123 (26%)
armadillo repeat 736..768 CDD:293788 11/32 (34%)
armadillo repeat 784..809 CDD:293788 7/26 (27%)
ARM 819..937 CDD:237987 33/147 (22%)
armadillo repeat 826..851 CDD:293788 6/24 (25%)
armadillo repeat 868..893 CDD:293788 5/32 (16%)
armadillo repeat 901..937 CDD:293788 9/55 (16%)
armadillo repeat 943..977 CDD:293788 4/33 (12%)
ARM 987..1109 CDD:237987 26/125 (21%)
HEAT repeat 990..1019 CDD:293787 9/32 (28%)
armadillo repeat 1025..1071 CDD:293788 8/45 (18%)
armadillo repeat 1077..1108 CDD:293788 8/30 (27%)
armadillo repeat 1165..1202 CDD:293788 6/36 (17%)
armadillo repeat 1210..1243 CDD:293788 10/64 (16%)
ARM 1212..1310 CDD:237987 27/129 (21%)
armadillo repeat 1249..1283 CDD:293788 10/33 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592314
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.