DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment arm and uck2b

DIOPT Version :9

Sequence 1:	NP_001259149.1	Gene:	arm / 31151	FlyBaseID:	FBgn0000117	Length:	843	Species:	Drosophila melanogaster
Sequence 2:	NP_956058.1	Gene:	uck2b / 327057	ZFINID:	ZDB-GENE-030131-5265	Length:	261	Species:	Danio rerio

Alignment Length:	141	Identity:	31/141 - (21%)
Similarity:	58/141 - (41%)	Gaps:	30/141 - (21%)

- Green bases have known domain annotations that are detailed below.

  Fly   592 ILARESHNRALIRQQSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAEIIEQEGATGPLTDL 656
            ||:::|..|.|..:|....:..:..|:..:...       .||.. |...:||:.:....|:.|.
Zfish    60 ILSQDSFYRELTPEQKAKAVKGQFNFDHPDAFD-------SELIM-KTLRDIIQGKTVHIPVYDF 116

  Fly   657 L-HSRNEGVATY--AAAVLFR-----MSEDKPQDYKKRLSIE------LTNSLLREDNNIWANAD 707
            : |||.:...|.  |..|||.     .|::....:|.:|.::      |:..:||:.:.
Zfish   117 VTHSRKDEFLTLYPADVVLFEGILMFYSQEIRDLFKMKLFVDTDPDTRLSRRVLRDISE------ 175

  Fly   708 LGMGPDLQDML 718
              .|.:|:.:|
Zfish   176 --RGRELEQVL 184

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
arm	NP_001259149.1	Adaptin_N	<150..>314	CDD:331138
		armadillo repeat	161..186	CDD:293788
		armadillo repeat	193..231	CDD:293788
		armadillo repeat	238..270	CDD:293788
		armadillo repeat	278..314	CDD:293788
		armadillo repeat	320..355	CDD:293788
		Arm	361..398	CDD:278915
		armadillo repeat	362..397	CDD:293788
		armadillo repeat	410..435	CDD:293788
		Arm	439..481	CDD:278915
		armadillo repeat	443..481	CDD:293788
		armadillo repeat	490..525	CDD:293788
		Arm	597..636	CDD:278915	7/38 (18%)
		armadillo repeat	600..636	CDD:293788	6/35 (17%)
		armadillo repeat	641..675	CDD:293788	12/41 (29%)
uck2b	NP_956058.1	Udk	17..232	CDD:223645	31/141 (22%)
		UMPK	24..230	CDD:238981	31/141 (22%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	238..261
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0572
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900