DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arm and Uck2

DIOPT Version :9

Sequence 1:NP_001259149.1 Gene:arm / 31151 FlyBaseID:FBgn0000117 Length:843 Species:Drosophila melanogaster
Sequence 2:XP_038946718.1 Gene:Uck2 / 304944 RGDID:620742 Length:267 Species:Rattus norvegicus


Alignment Length:141 Identity:33/141 - (23%)
Similarity:57/141 - (40%) Gaps:30/141 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   592 ILARESHNRALIRQQSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAEIIEQEGATGPLTDL 656
            ||:::|..|.|..:|....:..:..|:..:....       ||.. |...||.|.:....|:.|.
  Rat    64 ILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDN-------ELIF-KTLKEITEGKTVQIPVYDF 120

  Fly   657 L-HSRNEGVATY--AAAVLFR-----MSEDKPQDYKKRLSIE------LTNSLLREDNNIWANAD 707
            : |||.|...|.  |..|||.     .|::....::.:|.::      |:..:||:.:.      
  Rat   121 VSHSRKEETVTIYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISE------ 179

  Fly   708 LGMGPDLQDML 718
              .|.||:.:|
  Rat   180 --RGRDLEQIL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
armNP_001259149.1 Adaptin_N <150..>314 CDD:331138
armadillo repeat 161..186 CDD:293788
armadillo repeat 193..231 CDD:293788
armadillo repeat 238..270 CDD:293788
armadillo repeat 278..314 CDD:293788
armadillo repeat 320..355 CDD:293788
Arm 361..398 CDD:278915
armadillo repeat 362..397 CDD:293788
armadillo repeat 410..435 CDD:293788
Arm 439..481 CDD:278915
armadillo repeat 443..481 CDD:293788
armadillo repeat 490..525 CDD:293788
Arm 597..636 CDD:278915 7/38 (18%)
armadillo repeat 600..636 CDD:293788 6/35 (17%)
armadillo repeat 641..675 CDD:293788 14/41 (34%)
Uck2XP_038946718.1 UMPK 38..234 CDD:238981 33/141 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.