DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arm and Uck1

DIOPT Version :9

Sequence 1:NP_001259149.1 Gene:arm / 31151 FlyBaseID:FBgn0000117 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_001365720.1 Gene:Uck1 / 22245 MGIID:98904 Length:301 Species:Mus musculus


Alignment Length:319 Identity:58/319 - (18%)
Similarity:103/319 - (32%) Gaps:114/319 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 AIVDAGGMQALAMHLGNMSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGSTDVN----- 423
            |....||.::.|.......||..      |..:|...  ..|...:.:.::::||..:|:     
Mouse     8 ASAGGGGSESAAPEADRPQPRPF------LIGVSGGT--ASGKSTVCEKIMELLGQNEVDRRQRK 64

  Fly   424 VVTCAAGILSNLTCNNQRNKATVCQVG-------GVDALVRTIINAGDREEITEPAVCALRHLTS 481
            :|..:......:....|:.||...|..       ..|.:.:|:.|..:.:.:..|....:.|   
Mouse    65 LVILSQDCFYKVLTAEQKAKALKGQYNFDHPDAFDNDLMHKTLKNIVEGKTVEVPTYDFVTH--- 126

  Fly   482 RHVDSELAQNAVRLNYGLSVIVKLLHPPSRWPLIKAVIGL----IRNLALCPANHAPLREHGAIH 542
                |.|.:..|  .|...|:           |.:.::..    ||::                .
Mouse   127 ----SRLPETTV--VYPADVV-----------LFEGILVFYTQEIRDM----------------F 158

  Fly   543 HL---------VRLLMRAFQDTERQR--SSIAT--TGSQQPS---------AYADGVRMEEIVEG 585
            ||         |||..|..:|.:|.|  ..|.|  |...:|:         .|||          
Mouse   159 HLRLFVDTDSDVRLSRRVLRDVQRGRDLEQILTQYTAFVKPAFEEFCLPTKKYAD---------- 213

  Fly   586 TVGALHILARESHNRALIRQQS-----------VIPIFVRLLFNEIENIQRVAAGVLCE 633
                 .|:.|...|.|   .|:           ::|:.:.|:   :::||.:..|.||:
Mouse   214 -----VIIPRGVDNMA---DQARTLDCACPVGCLLPVAINLI---VQHIQDILNGDLCK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
armNP_001259149.1 Adaptin_N <150..>314 CDD:331138
armadillo repeat 161..186 CDD:293788
armadillo repeat 193..231 CDD:293788
armadillo repeat 238..270 CDD:293788
armadillo repeat 278..314 CDD:293788
armadillo repeat 320..355 CDD:293788
Arm 361..398 CDD:278915 7/33 (21%)
armadillo repeat 362..397 CDD:293788 7/32 (22%)
armadillo repeat 410..435 CDD:293788 4/29 (14%)
Arm 439..481 CDD:278915 9/48 (19%)
armadillo repeat 443..481 CDD:293788 8/44 (18%)
armadillo repeat 490..525 CDD:293788 6/38 (16%)
Arm 597..636 CDD:278915 10/48 (21%)
armadillo repeat 600..636 CDD:293788 9/45 (20%)
armadillo repeat 641..675 CDD:293788
Uck1NP_001365720.1 UMPK 31..254 CDD:238981 49/281 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0572
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.