DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment arm and B0001.4

DIOPT Version :9

Sequence 1:	NP_001259149.1	Gene:	arm / 31151	FlyBaseID:	FBgn0000117	Length:	843	Species:	Drosophila melanogaster
Sequence 2:	NP_502304.2	Gene:	B0001.4 / 178160	WormBaseID:	WBGene00007089	Length:	248	Species:	Caenorhabditis elegans

Alignment Length:	138	Identity:	29/138 - (21%)
Similarity:	53/138 - (38%)	Gaps:	34/138 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly   582 IVEGTVGALHILARESHNRALIRQQSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEG------ 640
            |||..:..|:..|::|.     ||..::.:.:...:.|:...:::.|         :||
Worm    24 IVERIIENLNANAKQSG-----RQIDIVHLSLHSFYRELSAEEKILA---------REGKFNFDH 74

  Fly   641 ---------AEIIEQ--EGATG--PLTDLLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSIELT 692
                     ||.::.  :|.|.  |..|::.|...|..|...|.:. :.|.....|.:|:...|:
Worm    75 PDQINFDLLAETLQNMIDGKTVEIPKYDMITSSMNGTVTVEPAKVI-IIEGILLLYDERVRKLLS 138

  Fly   693 NSLLREDN 700
            ..|..|.|
Worm   139 TKLFVEKN 146

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
arm	NP_001259149.1	Adaptin_N	<150..>314	CDD:331138
		armadillo repeat	161..186	CDD:293788
		armadillo repeat	193..231	CDD:293788
		armadillo repeat	238..270	CDD:293788
		armadillo repeat	278..314	CDD:293788
		armadillo repeat	320..355	CDD:293788
		Arm	361..398	CDD:278915
		armadillo repeat	362..397	CDD:293788
		armadillo repeat	410..435	CDD:293788
		Arm	439..481	CDD:278915
		armadillo repeat	443..481	CDD:293788
		armadillo repeat	490..525	CDD:293788
		Arm	597..636	CDD:278915	5/38 (13%)
		armadillo repeat	600..636	CDD:293788	4/35 (11%)
		armadillo repeat	641..675	CDD:293788	10/37 (27%)
B0001.4	NP_502304.2	Udk	1..223	CDD:223645	29/138 (21%)
B0001.4	NP_502304.2	UMPK	10..216	CDD:238981	29/138 (21%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0572
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900