DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL16 and FES1

DIOPT Version :10

Sequence 1:NP_525041.1 Gene:mRpL16 / 31150 FlyBaseID:FBgn0023519 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_009659.3 Gene:FES1 / 852397 SGDID:S000000305 Length:290 Species:Saccharomyces cerevisiae


Alignment Length:88 Identity:18/88 - (20%)
Similarity:37/88 - (42%) Gaps:18/88 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 YVTPIKAGRVIVEIAGK-------CEFVEVKQFLQQVANQLPFQATVVSQEM-LDEQRV------ 201
            |::.:|....|:.:..|       .|.:..:..|..:...|.|.:.::|..: .:||.:      
Yeast   203 YLSSVKIDENIISVLRKDGVIESTIECLSDESNLNIIDRVLSFLSHLISSGIKFNEQELHKLNEG 267

  Fly   202 ---AEEEQTRQNENPF-TMKYVI 220
               .|..:.|.||:.: .:|||:
Yeast   268 YKHIEPLKDRLNEDDYLAVKYVL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL16NP_525041.1 Ribosomal_L16 61..191 CDD:459733 8/46 (17%)
FES1NP_009659.3 Fes1 1..82 CDD:462534
SPK 125..224 CDD:472233 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.