DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL16 and MRPL16

DIOPT Version :9

Sequence 1:NP_001259148.1 Gene:mRpL16 / 31150 FlyBaseID:FBgn0023519 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_009515.1 Gene:MRPL16 / 852242 SGDID:S000000134 Length:232 Species:Saccharomyces cerevisiae


Alignment Length:202 Identity:45/202 - (22%)
Similarity:84/202 - (41%) Gaps:34/202 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LSLKLVSQLFKQSLASGNMAIVNTAGLKYFAPPIKYQNVEQPERPKLRVIERQPQLPPNIRPPKM 66
            ||:|:.....|:|  |.|..:.||...:.|    |::..     |:.:::::           |.
Yeast    10 LSIKMGGLTLKES--SPNAFLNNTTIARRF----KHEYA-----PRFKIVQK-----------KQ 52

  Fly    67 QKRLRYMRGPEMVHNTLLHKQYAI------VATGGGRLRWGHYEMMRLTIGRKMNVNTMFATWRV 125
            :.|:....|..:..:||...:|.:      :.....:|:.....:||..  |.:|...:   ||.
Yeast    53 KGRVPVRTGGSIKGSTLQFGKYGLRLKSEGIRISAQQLKEADNAIMRYV--RPLNNGHL---WRR 112

  Fly   126 PAPWQPITKKGQGQRMGGGKGAIDHYVTPIKAGRVIVEIAGKCEFVEV-KQFLQQVANQLPFQAT 189
            ......:..||...|||.|||..||::..:..|:::.||.|.....:| ::..::...:||....
Yeast   113 LCTNVAVCIKGNETRMGKGKGGFDHWMVRVPTGKILFEINGDDLHEKVAREAFRKAGTKLPGVYE 177

  Fly   190 VVSQEML 196
            .||.:.|
Yeast   178 FVSLDSL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL16NP_001259148.1 Ribosomal_L16 64..184 CDD:278672 28/126 (22%)
MRPL16NP_009515.1 Ribosomal_L16_L10e 42..174 CDD:412329 30/152 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343993
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002930
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101573
Panther 1 1.100 - - LDO PTHR12220
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2260
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.