DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL16 and rpl16

DIOPT Version :9

Sequence 1:NP_001259148.1 Gene:mRpL16 / 31150 FlyBaseID:FBgn0023519 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_051095.1 Gene:rpl16 / 844722 -ID:- Length:135 Species:Arabidopsis thaliana


Alignment Length:117 Identity:27/117 - (23%)
Similarity:57/117 - (48%) Gaps:14/117 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 VATGGGRLRWGHYEMM----------RLTIGRK---MNVNTMFATWRVPAPWQPITKKGQGQRMG 142
            :::.|.|:.:|.|.:.          ::..||:   .||......|....|.:|:|.:....|||
plant    20 ISSRGNRICFGRYALQTLEPAWITSRQIEAGRRAMTRNVRRGGKIWVRIFPDKPVTVRPAETRMG 84

  Fly   143 GGKGAIDHYVTPIKAGRVIVEIAGKCEFVEVKQFLQQVANQLPFQATVVSQE 194
            .|||:.:::|..:|.|:::.|:.|..|.: .::.:...|:::|.:...:..|
plant    85 SGKGSPEYWVAVVKPGKILYEMGGVPENI-ARKAISIAASKMPIKTQFIISE 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL16NP_001259148.1 Ribosomal_L16 64..184 CDD:278672 25/105 (24%)
rpl16NP_051095.1 rpl16 1..135 CDD:176985 26/115 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002930
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101573
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.