DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL16 and Fes1C

DIOPT Version :10

Sequence 1:NP_525041.1 Gene:mRpL16 / 31150 FlyBaseID:FBgn0023519 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_195835.1 Gene:Fes1C / 831805 AraportID:AT5G02150 Length:324 Species:Arabidopsis thaliana


Alignment Length:74 Identity:15/74 - (20%)
Similarity:30/74 - (40%) Gaps:0/74 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 HYVTPIKAGRVIVEIAGKCEFVEVKQFLQQVANQLPFQATVVSQEMLDEQRVAEEEQTRQNENPF 214
            |.|||.....::.|:....|.:::...|..|...:|....:.:.......:.|:...|....||.
plant    68 HEVTPQDIEGLLDELQEHVESIDMANDLHSVGGLVPLLGYLKNSNANIRAKSADVVSTIVENNPR 132

  Fly   215 TMKYVIQNN 223
            :.:.|::.|
plant   133 SQESVMEAN 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL16NP_525041.1 Ribosomal_L16 61..191 CDD:459733 9/40 (23%)
Fes1CNP_195835.1 Fes1 9..95 CDD:462534 6/26 (23%)
armadillo repeat 94..126 CDD:293788 4/31 (13%)
armadillo repeat 134..171 CDD:293788 2/8 (25%)
armadillo repeat 177..211 CDD:293788
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.