DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL16 and Fes1B

DIOPT Version :10

Sequence 1:NP_525041.1 Gene:mRpL16 / 31150 FlyBaseID:FBgn0023519 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_190948.1 Gene:Fes1B / 824547 AraportID:AT3G53800 Length:363 Species:Arabidopsis thaliana


Alignment Length:72 Identity:13/72 - (18%)
Similarity:30/72 - (41%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 VTPIKAGRVIVEIAGKCEFVEVKQFLQQVANQLPFQATVVSQEMLDEQRVAEEEQTRQNENPFTM 216
            |||.....::.|:....|.:::...|..:...:|..:.:.:.......:.|:...|....||.:.
plant    70 VTPDDLEGMLAELQEHVESIDLANDLHSIGGLVPLLSYLKNSNAKIRAKSADVLTTVVQNNPRSQ 134

  Fly   217 KYVIQNN 223
            :.|::.|
plant   135 QLVMEAN 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL16NP_525041.1 Ribosomal_L16 61..191 CDD:459733 7/38 (18%)
Fes1BNP_190948.1 Fes1 9..95 CDD:462534 5/24 (21%)
armadillo repeat 102..126 CDD:293788 2/23 (9%)
armadillo repeat 134..171 CDD:293788 2/8 (25%)
armadillo repeat 177..211 CDD:293788
armadillo repeat 219..250 CDD:293788
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.