DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL16 and Hspbp1

DIOPT Version :9

Sequence 1:NP_001259148.1 Gene:mRpL16 / 31150 FlyBaseID:FBgn0023519 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001347558.1 Gene:Hspbp1 / 66245 MGIID:1913495 Length:357 Species:Mus musculus


Alignment Length:236 Identity:45/236 - (19%)
Similarity:71/236 - (30%) Gaps:90/236 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PPIKYQNVEQPERPKLRVIERQPQLPPNIRPPKMQKRLRYM--------RGP----EMVHNTLLH 85
            ||...|.:.|   ..:....::|..||.   |..::|.:::        ||.    |.:.|.|..
Mouse    39 PPRNLQGLLQ---MAITAGSQEPDPPPE---PMSEERRQWLQEAMSAAFRGQREEVEQMKNCLRV 97

  Fly    86 KQYAIVATGG-------GRLRWGHYEM-------------------MRLTIGRKMNVNTMFATWR 124
            ...|..|..|       .:.|.|..|:                   |.|.:||.:........||
Mouse    98 LSQATPAMAGEAELATDQQEREGALELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWR 162

  Fly   125 VPAPWQPITKKGQGQRMG---GGKGAIDHYVTPIKAGRVIVEIAGK--CEFVEVK---------- 174
            .            .|.:|   ....||...|..:.|.|.::.:..:  |:.|.||          
Mouse   163 A------------AQLIGTCSQNVAAIQEQVLGLGALRKLLRLLDRDSCDTVRVKALFAISCLVR 215

  Fly   175 -------QFL------------QQVANQLPFQATVVSQEML 196
                   |||            ||...:|..::..:.|.:|
Mouse   216 EQEAGLLQFLRLDGFSVLMRAMQQQVQKLKVKSAFLLQNLL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL16NP_001259148.1 Ribosomal_L16 64..184 CDD:278672 35/191 (18%)
Hspbp1NP_001347558.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..68 8/34 (24%)
Fes1 43..137 CDD:369996 18/99 (18%)
ARM 1 130..172 8/53 (15%)
armadillo repeat 135..172 CDD:293788 8/48 (17%)
ARM 2 175..215 9/39 (23%)
armadillo repeat 178..213 CDD:293788 7/34 (21%)
ARM 3 218..257 8/39 (21%)
armadillo repeat 231..255 CDD:293788 4/23 (17%)
ARM 4 260..299
armadillo repeat 263..299 CDD:293788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.