DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL16 and MRPL16

DIOPT Version :9

Sequence 1:NP_001259148.1 Gene:mRpL16 / 31150 FlyBaseID:FBgn0023519 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_060310.1 Gene:MRPL16 / 54948 HGNCID:14476 Length:251 Species:Homo sapiens


Alignment Length:221 Identity:113/221 - (51%)
Similarity:149/221 - (67%) Gaps:7/221 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 TAGLKYFAPPIKYQNVEQPERPKLRVIERQPQLPPNIRPPKMQKRLRYMRGPEMVHNTLLHKQYA 89
            :||:|...|...:::|..||:||||.|||.|.:|...|.|   |.|..:|||...........:|
Human    27 SAGVKTLLPVPSFEDVSIPEKPKLRFIERAPLVPKVRREP---KNLSDIRGPSTEATEFTEGNFA 88

  Fly    90 IVATGGGRLRWGHYEMMRLTIGRKMNVNTMFATWRVPAPWQPITKKGQGQRMGGGKGAIDHYVTP 154
            |:|.|||.|.|||:|||||||.|.|:...|||.||||||::|||:|..|.|||||||||||||||
Human    89 ILALGGGYLHWGHFEMMRLTINRSMDPKNMFAIWRVPAPFKPITRKSVGHRMGGGKGAIDHYVTP 153

  Fly   155 IKAGRVIVEIAGKCEFVEVKQFLQQVANQLPFQATVVSQEMLDEQRVAEEEQTRQNENPFTMKYV 219
            :||||::||:.|:|||.||:.||.|||::|||.|..||:..|::.|..:||:.|.|:||:|.:.:
Human   154 VKAGRLVVEMGGRCEFEEVQGFLDQVAHKLPFAAKAVSRGTLEKMRKDQEERERNNQNPWTFERI 218

  Fly   220 IQNNLSGCHRWLSPVD--H--KWFGK 241
            ...|:.|..:.|||.|  |  |::||
Human   219 ATANMLGIRKVLSPYDLTHKGKYWGK 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL16NP_001259148.1 Ribosomal_L16 64..184 CDD:278672 71/119 (60%)
MRPL16NP_060310.1 Ribosomal_L16 60..190 CDD:395194 77/132 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147771
Domainoid 1 1.000 160 1.000 Domainoid score I4074
eggNOG 1 0.900 - - E1_COG0197
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9872
Inparanoid 1 1.050 222 1.000 Inparanoid score I3551
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45726
OrthoDB 1 1.010 - - D1420525at2759
OrthoFinder 1 1.000 - - FOG0002930
OrthoInspector 1 1.000 - - oto90204
orthoMCL 1 0.900 - - OOG6_101573
Panther 1 1.100 - - LDO PTHR12220
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5004
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.