DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL16 and RpL10

DIOPT Version :9

Sequence 1:NP_001259148.1 Gene:mRpL16 / 31150 FlyBaseID:FBgn0023519 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001262233.1 Gene:RpL10 / 43864 FlyBaseID:FBgn0024733 Length:218 Species:Drosophila melanogaster


Alignment Length:198 Identity:39/198 - (19%)
Similarity:71/198 - (35%) Gaps:49/198 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 YQNVEQPERPKLRVIERQPQLPPNIRPPKM-QKRLRYMRGPEMVHNTLL---HKQYAIVATGGGR 97
            |:..:....||.|.....|.  |.||...: :|:......|..||  |:   ::|.:..|...||
  Fly     9 YRYCKNKPYPKSRFCRGVPD--PKIRIFDLGRKKATVEDFPLCVH--LVSDEYEQLSSEALEAGR 69

  Fly    98 LRWGHYEM-----------MRLTIGRKMNVNTMFATWRVPAPWQPITKKGQGQRMGGGKGAI--- 148
            :....|.:           |||.....:.:|.|            ::..|..:...|.:||.   
  Fly    70 ICCNKYLVKYCGKDQFHIRMRLHPFHVIRINKM------------LSCAGADRLQTGMRGAFGKP 122

  Fly   149 DHYVTPIKAGRVIVEIAGKCEF-VEVKQFLQQVANQLP-FQATVVS-------------QEMLDE 198
            ...|..::.|:.|:.:.....: .:|.:.|::...:.| .|...||             :|:.|:
  Fly   123 QGTVARVRIGQPIMSVRSSDRYKAQVIEALRRAKFKFPGRQKIYVSKKWGFTKYERERYEELRDD 187

  Fly   199 QRV 201
            .|:
  Fly   188 NRL 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL16NP_001259148.1 Ribosomal_L16 64..184 CDD:278672 24/138 (17%)
RpL10NP_001262233.1 PTZ00173 1..213 CDD:185498 39/198 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0197
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.