DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL16 and AT2G28815

DIOPT Version :10

Sequence 1:NP_525041.1 Gene:mRpL16 / 31150 FlyBaseID:FBgn0023519 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001325273.1 Gene:AT2G28815 / 28718313 AraportID:AT2G28815 Length:291 Species:Arabidopsis thaliana


Alignment Length:162 Identity:42/162 - (25%)
Similarity:71/162 - (43%) Gaps:27/162 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 NVEQPERPKLRVIERQPQ---------LPPNIRPPKMQKRLRYMRGPEMVHNTLLHKQYAIVA-- 92
            |.::.::.|..|.|::|:         :|   |..|.||..|......:.....:..:||:..  
plant   133 NEKKQQKQKSSVNEKKPKKKKKSSISDIP---RRTKFQKHHRGRINKGVSSQGYICSRYALQTLE 194

  Fly    93 ---TGGGRLRWGHYEMMRLTIGRKMNVNT-MFATWRVPAPWQPITKKGQGQRMGGGKGAIDHYVT 153
               ....::..|...|.| .|||.:.|.. :||.       :|:|.:....|||.||||...:|.
plant   195 PAWITSRQIEAGRRAMTR-NIGRGLTVRVHIFAD-------KPVTVRPPETRMGRGKGAPAFWVA 251

  Fly   154 PIKAGRVIVEIAGKCEFVEVKQFLQQVANQLP 185
            .:|.|::|.|:.|..|.| .::.:...|::||
plant   252 VVKPGKIIYEMGGVSEKV-AREAISIAASKLP 282

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
mRpL16NP_525041.1 Ribosomal_L16 61..191 CDD:459733 36/131 (27%)