DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL16 and mrpl16

DIOPT Version :9

Sequence 1:NP_001259148.1 Gene:mRpL16 / 31150 FlyBaseID:FBgn0023519 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_596459.1 Gene:mrpl16 / 2539752 PomBaseID:SPBC1105.03c Length:215 Species:Schizosaccharomyces pombe


Alignment Length:191 Identity:48/191 - (25%)
Similarity:71/191 - (37%) Gaps:50/191 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 QLPPNIRPPKMQKRLR--YMRGPEMVHNTLLHKQYAIVATGGG----RLRWGHYEMMRLTIGRKM 114
            |:||      :|..:|  :...|..:.|....|....:..||.    :|.||.|.|      |..
pombe    26 QMPP------IQTMVRWGHQYAPRSIRNQKAQKGRVPIPIGGSLRGTQLEWGEYGM------RLK 78

  Fly   115 NVNTMFATWRVPAPWQ----------------------PITKKGQGQRMGGGKGAIDHYVTPIKA 157
            :.:..|...::....|                      |:..||...|||.||||.:::...|..
pombe    79 DRSIRFHAKQLETAEQILKRILKPIKAARVYTRFCCNVPVCVKGNETRMGKGKGAFEYWAARIPI 143

  Fly   158 GRVIVEIAG---KCEFVEVKQFLQQVANQLPFQATVVSQEMLDEQRVAEEEQTRQNENPFT 215
            |||:.||.|   :.|..|  ..|:|.|..||.:     .|::.:|.......|..:|.|.|
pombe   144 GRVLFEIGGDGMRKELAE--HALKQAAFHLPGK-----YEIIVKQTPKRLGTTLIHETPIT 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL16NP_001259148.1 Ribosomal_L16 64..184 CDD:278672 37/150 (25%)
mrpl16NP_596459.1 RplP 38..188 CDD:223275 39/162 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002930
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101573
Panther 1 1.100 - - LDO PTHR12220
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2260
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.