DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL16 and Hspbp1

DIOPT Version :9

Sequence 1:NP_001259148.1 Gene:mRpL16 / 31150 FlyBaseID:FBgn0023519 Length:243 Species:Drosophila melanogaster
Sequence 2:XP_038955262.1 Gene:Hspbp1 / 246146 RGDID:628677 Length:361 Species:Rattus norvegicus


Alignment Length:263 Identity:53/263 - (20%)
Similarity:86/263 - (32%) Gaps:98/263 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 QPQLPPNIRPPKMQKRLRYM--------RGP----EMVHNTLLHKQYAIVATGG-------GRLR 99
            :|..||.   |..::|.:::        ||.    |.:.|.|.....|...|.|       .:.|
  Rat    57 EPDPPPE---PMSEERRQWLQEAMSAAFRGQREEVEQMKNCLRVLSQATPPTAGEAELATDQQER 118

  Fly   100 WGHYEM-------------------MRLTIGRKMNVNTMFATWRVPAPWQPITKKGQGQRMG--- 142
            .|..|:                   |.|.:||.:........||.            .|.:|   
  Rat   119 EGALELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRA------------AQLIGTCS 171

  Fly   143 GGKGAIDHYVTPIKAGRVIVEIAGK--CEFVEVKQFL-------QQVANQLPFQA----TVVSQE 194
            ....||...|..:.|.|.::.:..:  |:.|.||...       :|.|..|.|..    :|:.:.
  Rat   172 QNVAAIQEQVLGLGALRKLLRLLDRDSCDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRA 236

  Fly   195 MLDEQRVAEEEQTRQNENPFTMKYVIQNNLSGC--HRWLSP-----------------VDHKWFG 240
            |  :|:|    |..:.::.|    ::||.|.|.  |:.|.|                 .:|..|.
  Rat   237 M--QQQV----QKLKVKSAF----LLQNLLVGHPEHKALPPGTLCSMGMVQQLVALVRTEHSPFH 291

  Fly   241 KHL 243
            :|:
  Rat   292 EHV 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL16NP_001259148.1 Ribosomal_L16 64..184 CDD:278672 32/169 (19%)
Hspbp1XP_038955262.1 Fes1 43..137 CDD:400776 16/82 (20%)
armadillo repeat 135..172 CDD:293788 8/48 (17%)
armadillo repeat 178..213 CDD:293788 7/34 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.