DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL16 and RPL10L

DIOPT Version :9

Sequence 1:NP_001259148.1 Gene:mRpL16 / 31150 FlyBaseID:FBgn0023519 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_542784.1 Gene:RPL10L / 140801 HGNCID:17976 Length:214 Species:Homo sapiens


Alignment Length:103 Identity:22/103 - (21%)
Similarity:41/103 - (39%) Gaps:20/103 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 QYAIVATGGGRLRWGHYEMMRLTIGRKMNVNTMFATWRVPAPWQPITKKGQGQRMGGGKGAI--- 148
            :|.:.:.|    |.|.:..:||.....:.:|.|            ::..|..:...|.:||.   
Human    74 KYMVKSCG----RDGFHMRVRLHPFHVIRINKM------------LSCAGADRLQTGMRGAFGKP 122

  Fly   149 DHYVTPIKAGRVIVEIAGKCEFVE-VKQFLQQVANQLP 185
            ...|..:..|:||:.|..|.:..| |.:.|::...:.|
Human   123 QGTVARVHIGQVIMSIRTKLQNEEHVIEALRRAKFKFP 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL16NP_001259148.1 Ribosomal_L16 64..184 CDD:278672 21/100 (21%)
RPL10LNP_542784.1 PTZ00173 1..209 CDD:185498 22/103 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.