DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trr and SET3

DIOPT Version :9

Sequence 1:NP_726773.2 Gene:trr / 31149 FlyBaseID:FBgn0023518 Length:2431 Species:Drosophila melanogaster
Sequence 2:NP_012954.3 Gene:SET3 / 853900 SGDID:S000001737 Length:751 Species:Saccharomyces cerevisiae


Alignment Length:167 Identity:42/167 - (25%)
Similarity:65/167 - (38%) Gaps:42/167 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  2273 QFVHSKSSQYKKMKQEWRNNVYLARSK----IQGLGLYAARDIEKHTMIIEYIGEVIRTEVSEIR 2333
            |:.|   ..:|.:..|.:....:|.|:    ...||:|..:|..|...|.|.:||:       ..
Yeast   304 QYPH---KTFKSVSIEVKPYADIAYSRTYPGFTKLGVYLKKDCIKGDFIQEILGEL-------DF 358

  Fly  2334 EKQYESKNRGIY----------MFRLDEDRVVDATLSGGLARYINHSCNPNCVTEIVEV---DRD 2385
            .|.|.:..|..|          :|.......:||.|||...||:..||.||  .|:|.:   |.|
Yeast   359 YKNYLTDPRNHYRIWGTAKRRVIFHSHWPIYIDARLSGNSTRYLRRSCQPN--VELVTIKLQDTD 421

  Fly  2386 -------------VRIIIFAKRKIYRGEELSYDYKFD 2409
                         ::.::.|.|.|...|||...:::|
Yeast   422 NRNDKSSGRKSSRIKFVLRALRDISEDEELYIKWQWD 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trrNP_726773.2 PHA03255 184..>320 CDD:165513
ePHD2_KMT2C_like 1898..2002 CDD:277136
FYRN 2068..2118 CDD:283589
FYRC 2126..2215 CDD:197781
SET <2266..2431 CDD:225491 42/167 (25%)
SET 2291..2413 CDD:214614 38/149 (26%)
PostSET 2415..2431 CDD:214703
SET3NP_012954.3 PHD_MLL5 119..163 CDD:277025
SET 217..722 CDD:225491 42/167 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4489
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.