DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trr and BYE1

DIOPT Version :9

Sequence 1:NP_726773.2 Gene:trr / 31149 FlyBaseID:FBgn0023518 Length:2431 Species:Drosophila melanogaster
Sequence 2:NP_012921.3 Gene:BYE1 / 853865 SGDID:S000001488 Length:594 Species:Saccharomyces cerevisiae


Alignment Length:381 Identity:74/381 - (19%)
Similarity:125/381 - (32%) Gaps:113/381 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 HAENSGK---SEDLDY---VLMPASGADSSTSVGNSTGTGTPAGTPIGATTSTIILNANNGTAGV 254
            |.|.|.:   |||.||   |..|.:..|.     |.........:|         ..........
Yeast   138 HLETSKEAEVSEDEDYHDDVYKPVNDHDD-----NDADVFLDEESP---------RKRKRSPDSA 188

  Fly   255 SGAGTTTILTQKSGHTNYNIFNTTATGSQTPTTTLLNRVNLHPKMKTQLMVNAKKLSEVTQTTAK 319
            .|....:...:||..:.....:..|..|.|....:..|.:...:.:.:|..||:|:..       
Yeast   189 KGIHIKSKQVKKSNGSKKRNKSIDAAKSDTAENEMPTRKDFESEKEHKLRYNAEKMFS------- 246

  Fly   320 VSIGNKTISVPLLKPLMSASGAATAGGATIVESKQLLQPGGQVTTVMSAAQQSGGQQVHPHVHSH 384
             ::.:|.| ||                 ..:|:|....|.|:  .|:|.:|:..           
Yeast   247 -TLFSKFI-VP-----------------ETIEAKLYELPDGK--DVISISQEFA----------- 279

  Fly   385 AHHNFTKLIKRGPKNSGTIVSFSGLQIKPANTKIVATKVVS-------KKMLQLQQHQQQIQQQQ 442
              ||..:.:.:...|    |.|..|.      ||...||.|       ||.|:|:.|  .::.:.
Yeast   280 --HNLEEELYKACLN----VEFGTLD------KIYTEKVRSLYSNLKDKKNLELKAH--VVEGKL 330

  Fly   443 QLQQLQVTSGGGLAPPTGSIVTITTTNPSQTYAMVQDSATVGP------AAHSED----DAPAPR 497
            .|.:|...:...||.|     .:......:...::::.....|      ..|..|    |...|:
Yeast   331 PLNKLVNMNASELANP-----DLQEFKEKRDKIILENFIVEVPDKPMYVKTHKGDELIEDIAEPQ 390

  Fly   498 KITAYSENLQKILN-------KSKSQES---TGGPEEFTNINSVVIKPLDKNTLNC 543
            :...||::..::.|       |||.:::   :..|...|.||        :.:|||
Yeast   391 EDILYSKDSIRLHNIDSIDSDKSKIEQTHAISKEPSPSTIIN--------EESLNC 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trrNP_726773.2 PHA03255 184..>320 CDD:165513 24/129 (19%)
ePHD2_KMT2C_like 1898..2002 CDD:277136
FYRN 2068..2118 CDD:283589
FYRC 2126..2215 CDD:197781
SET <2266..2431 CDD:225491
SET 2291..2413 CDD:214614
PostSET 2415..2431 CDD:214703
BYE1NP_012921.3 PHD_Bye1p_SIZ1_like 74..131 CDD:277045
TFS2M 235..354 CDD:128786 36/176 (20%)
SPOC 434..589 CDD:400205 3/5 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4489
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.