DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trr and SET4

DIOPT Version :9

Sequence 1:NP_726773.2 Gene:trr / 31149 FlyBaseID:FBgn0023518 Length:2431 Species:Drosophila melanogaster
Sequence 2:NP_012430.1 Gene:SET4 / 853339 SGDID:S000003641 Length:560 Species:Saccharomyces cerevisiae


Alignment Length:403 Identity:88/403 - (21%)
Similarity:151/403 - (37%) Gaps:118/403 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  2107 RPNRRCRYICSIAEAGCKPEFRIQVQDA-----------GDKEP-EREF---RGSSPSAVWQQIL 2156
            :|...|  ||..:::  |.|..||....           ...:| :|:|   |..|.:.|....:
Yeast   158 KPKNGC--ICGSSDS--KDELFIQCNKCKTWQHKLCYAFKKSDPIKRDFVCKRCDSDTKVQVNQV 218

  Fly  2157 QPITRLRKVHKWLQLFPQHISGEDLFGLTEPAIV--------RILESLPGIETLTDYRFKYGRNP 2213
            :|:           :||:.:..|.||..:  :||        :..:|:..||.....|..:...|
Yeast   219 KPM-----------IFPRKMGDERLFQFS--SIVTTSASNTNQHQQSVNNIEEQPKKRQLHYTAP 270

  Fly  2214 LLEFPLAINPSGAARTEPKQRQLLV---WRKPHTQRTAGSCSTQRMANSAAIAGEVACPYSKQFV 2275
            ..|      .|.:.|.:.:|.:|:|   :.||.....:.|..|:   ..|....|....|.|.|:
Yeast   271 TTE------NSNSIRKKLRQEKLVVSSHFLKPLLNEVSSSNDTE---FKAITISEYKDKYVKMFI 326

  Fly  2276 HSKSSQYKKMKQEWRN----NVYLARSKIQ-GLGLYAARDIEKHTMIIEYIGEVIRTEVSEIREK 2335
            .:.......:...|.:    ::.:.:|..: ..|::||....|..:|.||:|::       ..:|
Yeast   327 DNHYDDDWVVCSNWESSRSADIEVRKSSNERDFGVFAADSCVKGELIQEYLGKI-------DFQK 384

  Fly  2336 QYESKNRGIY----------MFRLDEDRVVDATLSGGLARYINHSCNPNCVTEIVEV-------- 2382
            .|::.....|          :|.......:|:..:|||.|||..||.||  .|:|.|        
Yeast   385 NYQTDPNNDYRLMGTTKPKVLFHPHWPLYIDSRETGGLTRYIRRSCEPN--VELVTVRPLDEKPR 447

  Fly  2383 -DRDVRI--IIFAKRKIYRGEELSYDYKFDIEDESHKI--------------------------- 2417
             |.|.|:  ::.|.|.|.:|||:|.::::|:.:...:|                           
Yeast   448 GDNDCRVKFVLRAIRDIRKGEEISVEWQWDLRNPIWEIINASKDLDSLPDPDKFWLMGSIKTILT 512

  Fly  2418 --PCACG--APNC 2426
              .||||  ..||
Yeast   513 NCDCACGYLGHNC 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trrNP_726773.2 PHA03255 184..>320 CDD:165513
ePHD2_KMT2C_like 1898..2002 CDD:277136
FYRN 2068..2118 CDD:283589 4/10 (40%)
FYRC 2126..2215 CDD:197781 22/111 (20%)
SET <2266..2431 CDD:225491 49/218 (22%)
SET 2291..2413 CDD:214614 38/147 (26%)
PostSET 2415..2431 CDD:214703 7/43 (16%)
SET4NP_012430.1 SET 16..526 CDD:225491 88/403 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4489
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.