DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trr and TBRG1

DIOPT Version :9

Sequence 1:NP_726773.2 Gene:trr / 31149 FlyBaseID:FBgn0023518 Length:2431 Species:Drosophila melanogaster
Sequence 2:NP_116200.2 Gene:TBRG1 / 84897 HGNCID:29551 Length:411 Species:Homo sapiens


Alignment Length:179 Identity:53/179 - (29%)
Similarity:91/179 - (50%) Gaps:21/179 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  2066 VGNMTFLNVGQLLPHQLEAFHTPHYIYPIGYKVSRYYWCVRRPNRRCRYICSIAEAGCKPEFRIQ 2130
            :|.:|..::|:::..: ..||....|||:||..:|.|..::.|:::|.|.|.|.:.|.:|:|.|.
Human   187 LGGLTVYSLGEIITDR-PGFHDESAIYPVGYCSTRIYASMKCPDQKCLYTCQIKDGGVQPQFEIV 250

  Fly  2131 VQDAGDKEPEREFRGSSPSAVWQQILQPI-TRLRKVHKWLQLFPQHISGEDLFGLTEPAIVRILE 2194
            .:|    :|:.....||..|...::|:.| |.:.|:..  .|.|   :|.|.||.:.|||..:::
Human   251 PED----DPQNAIVSSSADACHAELLRTISTTMGKLMP--NLLP---AGADFFGFSHPAIHNLIQ 306

  Fly  2195 SLPGIETLTDYRF------KYGRNPLLEFPLAINPSGAART-EPKQRQL 2236
            |.||.....:|::      |.|...|   |..:..:.||.: |..|||:
Human   307 SCPGARKCINYQWVKFDVCKPGDGQL---PEGLPENDAAMSFEAFQRQI 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trrNP_726773.2 PHA03255 184..>320 CDD:165513
ePHD2_KMT2C_like 1898..2002 CDD:277136
FYRN 2068..2118 CDD:283589 15/49 (31%)
FYRC 2126..2215 CDD:197781 26/95 (27%)
SET <2266..2431 CDD:225491
SET 2291..2413 CDD:214614
PostSET 2415..2431 CDD:214703
TBRG1NP_116200.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..146
FYRN 189..238 CDD:283589 15/49 (31%)
FYRC 244..319 CDD:283590 25/83 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.