DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trr and ATX1

DIOPT Version :9

Sequence 1:NP_726773.2 Gene:trr / 31149 FlyBaseID:FBgn0023518 Length:2431 Species:Drosophila melanogaster
Sequence 2:NP_850170.1 Gene:ATX1 / 817721 AraportID:AT2G31650 Length:1062 Species:Arabidopsis thaliana


Alignment Length:608 Identity:129/608 - (21%)
Similarity:215/608 - (35%) Gaps:257/608 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly  2066 VGNMTFLNVGQLLPHQLEAFHTPHYIYPIGYKVSRYYWCVRRPNRRCRYICSI---AEAGCKPEF 2127
            :|::..:|:|:::... :.|...::|:|.||...|.:..:...:....|...:   ||....|.|
plant   446 IGDLLIINLGKVVTDS-QFFKDENHIWPEGYTAMRKFTSLTDHSASALYKMEVLRDAETKTHPLF 509

  Fly  2128 RIQVQDAGDKEPEREFRGSSPSAVWQQILQPITRLRKVHK--WLQLFPQHI--SGEDLFGLTEPA 2188
             |...|:|:     :|:|.:|||.|.:|   ..|::||..  ...:..:.:  ||.|:|||:.|.
plant   510 -IVTADSGE-----QFKGPTPSACWNKI---YNRIKKVQNSDSPNILGEELNGSGTDMFGLSNPE 565

  Fly  2189 IVRILESL--------------------------------------------------------- 2196
            ::::::.|                                                         
plant   566 VIKLVQDLSKSRPSSHVSMCKNSLGRHQNQPTGYRPVRVDWKDLDKCNVCHMDEEYENNLFLQCD 630

  Fly  2197 ----------------------------PG-----------------IETLTDYRF--------- 2207
                                        ||                 ::..||.|:         
plant   631 KCRMMVHAKCYGELEPCDGALWLCNLCRPGAPDMPPRCCLCPVVGGAMKPTTDGRWAHLACAIWI 695

  Fly  2208 ----------------------------------KYGR-------------NPL----------L 2215
                                              .||.             :||          |
plant   696 PETCLSDVKKMEPIDGVNKVSKDRWKLMCTICGVSYGACIQCSNNSCRVAYHPLCARAAGLCVEL 760

  Fly  2216 EFPLAI----------------------------------------------NPSGAARTEP--- 2231
            |..:::                                              ||||.|||||   
plant   761 ENDMSVEGEEADQCIRMLSFCKRHRQTSTACLGSEDRIKSATHKTSEYLPPPNPSGCARTEPYNC 825

  Fly  2232 ---------------KQRQLLVWRKPHTQRTAGSCSTQRMANSAAIAG-EVACPYSKQFVHSKSS 2280
                           ..::|.|..:|:   ..|..|....:...:|.| :|:...:...:.|.:.
plant   826 FGRRGRKEPEALAAASSKRLFVENQPY---VIGGYSRLEFSTYKSIHGSKVSQMNTPSNILSMAE 887

  Fly  2281 QYKKMKQEWRNNVYLARSKIQGLGLYAARDIEKHTMIIEYIGEVIRTEVSEIREKQ-YESK-NRG 2343
            :|:.|::.:|..:...:|.|.|.|::|........|:|||.||::|..:::.||:. |.|. ..|
plant   888 KYRYMRETYRKRLAFGKSGIHGFGIFAKLPHRAGDMMIEYTGELVRPSIADKREQLIYNSMVGAG 952

  Fly  2344 IYMFRLDEDRVVDATLSGGLARYINHSCNPNCVTEIVEVDRDVRIIIFAKRKIYRGEELSYDYKF 2408
            .||||:|::||:|||.:|.:|..|||||.|||.:.::.|:.|..|||||||.|.:.|||:|||:|
plant   953 TYMFRIDDERVIDATRTGSIAHLINHSCVPNCYSRVITVNGDEHIIIFAKRHIPKWEELTYDYRF 1017

  Fly  2409 DIEDESHKIPCACGAPNCRKWMN 2431
            ....|  ::.|:||.|.||..:|
plant  1018 FSIGE--RLSCSCGFPGCRGVVN 1038

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trrNP_726773.2 PHA03255 184..>320 CDD:165513
ePHD2_KMT2C_like 1898..2002 CDD:277136
FYRN 2068..2118 CDD:283589 9/49 (18%)
FYRC 2126..2215 CDD:197781 31/260 (12%)
SET <2266..2431 CDD:225491 66/166 (40%)
SET 2291..2413 CDD:214614 54/123 (44%)
PostSET 2415..2431 CDD:214703 6/15 (40%)
ATX1NP_850170.1 TUDOR <215..248 CDD:295375
PWWP 299..389 CDD:279227
FYRN 448..497 CDD:283589 9/49 (18%)
FYRC 508..597 CDD:295414 22/97 (23%)
PHD_ATX1_2_like 611..657 CDD:276969 0/45 (0%)
ePHD_ATX1_2_like 668..784 CDD:277132 9/115 (8%)
SET 898..1017 CDD:214614 53/118 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1076
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.