DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trr and SUV39H1

DIOPT Version :10

Sequence 1:NP_726773.2 Gene:trr / 31149 FlyBaseID:FBgn0023518 Length:2431 Species:Drosophila melanogaster
Sequence 2:NP_001269095.1 Gene:SUV39H1 / 6839 HGNCID:11479 Length:423 Species:Homo sapiens


Alignment Length:159 Identity:52/159 - (32%)
Similarity:81/159 - (50%) Gaps:30/159 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  2301 QGLGLYAARDIEKHTMIIEYIGEVIRTEVSEIREKQYESKNRGIYMFRLD--ED-RVVDATLSGG 2362
            :|.|:.....|.|::.::||:||:|.:|.:|.|.:.|: :....|:|.||  || ..|||...|.
Human   265 RGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYD-RQGATYLFDLDYVEDVYTVDAAYYGN 328

  Fly  2363 LARYINHSCNPNCVTEIVEVD----RDVRIIIFAKRKIYRGEELSYDYKFDIE---------DES 2414
            ::.::||||:||.....|.:|    |..||..||.|.|..||||::||...::         |.:
Human   329 ISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEELTFDYNMQVDPVDMESTRMDSN 393

  Fly  2415 H-------------KIPCACGAPNCRKWM 2430
            .             :|.|.||..:|||::
Human   394 FGLAGLPGSPKKRVRIECKCGTESCRKYL 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trrNP_726773.2 PHA03255 184..>320 CDD:165513
PRK13914 <623..>851 CDD:237555
ePHD2_KMT2C_like 1898..2002 CDD:277136
FYRN 2067..2118 CDD:461787
FYRC 2126..2215 CDD:197781
SET_KMT2C_2D 2278..2430 CDD:380948 52/157 (33%)
SUV39H1NP_001269095.1 CD_SUV39H1_like 54..102 CDD:349289
SET_SUV39H1 169..423 CDD:380923 52/159 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.