DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trr and ezh1

DIOPT Version :9

Sequence 1:NP_726773.2 Gene:trr / 31149 FlyBaseID:FBgn0023518 Length:2431 Species:Drosophila melanogaster
Sequence 2:NP_001035072.2 Gene:ezh1 / 664754 ZFINID:ZDB-GENE-050114-1 Length:756 Species:Danio rerio


Alignment Length:142 Identity:55/142 - (38%)
Similarity:82/142 - (57%) Gaps:5/142 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly  2271 SKQFVHSKSSQYKKMKQEWRNNVYLARSKIQGLGLYAARDIEKHTMIIEYIGEVIRTEVSEIREK 2335
            |||......|..:.:|:    ::.||.|.:.|.|.:....::|:..|.||.||:|..:.::.|.:
Zfish   606 SKQVSCKNCSIQRGLKK----HLLLAPSDVAGWGTFIKEPVQKNEFISEYCGELISQDEADRRGR 666

  Fly  2336 QYESKNRGIYMFRLDEDRVVDATLSGGLARYINHSCNPNCVTEIVEVDRDVRIIIFAKRKIYRGE 2400
            .|: |....::|.|:.|.|||||..|...|:.|||.||||..::|.|:.|.||.|||||.|.:||
Zfish   667 IYD-KYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVVMVNGDHRIGIFAKRAIQQGE 730

  Fly  2401 ELSYDYKFDIED 2412
            ||.:||::...|
Zfish   731 ELFFDYRYSQAD 742

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trrNP_726773.2 PHA03255 184..>320 CDD:165513
ePHD2_KMT2C_like 1898..2002 CDD:277136
FYRN 2068..2118 CDD:283589
FYRC 2126..2215 CDD:197781
SET <2266..2431 CDD:225491 55/142 (39%)
SET 2291..2413 CDD:214614 50/122 (41%)
PostSET 2415..2431 CDD:214703
ezh1NP_001035072.2 EZH2_WD-Binding 45..73 CDD:288468
SANT 447..489 CDD:238096
SET <476..736 CDD:225491 52/134 (39%)
SET 622..743 CDD:214614 50/126 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593892
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.