DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trr and Setmar

DIOPT Version :10

Sequence 1:NP_726773.2 Gene:trr / 31149 FlyBaseID:FBgn0023518 Length:2431 Species:Drosophila melanogaster
Sequence 2:NP_001020219.1 Gene:Setmar / 500281 RGDID:1565882 Length:315 Species:Rattus norvegicus


Alignment Length:277 Identity:70/277 - (25%)
Similarity:111/277 - (40%) Gaps:70/277 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  2214 LLEFPLAINPSGAA-RTEPKQRQLLVWRKPH----------TQRTAGSCSTQRMANSAAIAGEVA 2267
            |...|:::.|.||. |.:|.|     :...|          ||.|...|:   ...:..:.|..:
  Rat    33 LENLPVSLWPLGAGPRPKPFQ-----YTPDHVAGPGVDMDPTQITFPGCA---CIKTPCVPGTCS 89

  Fly  2268 C-----PYSKQF-VHSKSSQYKKMKQEWRNNVYL-----ARSKI----------------QGLGL 2305
            |     .|:... :....|:.|..|..:..||..     .|:::                :|.||
  Rat    90 CLRHESNYNDNLCLRDVGSEAKYAKPVFECNVLCQCGEHCRNRVVQSGLQFLLQVFQTEKKGWGL 154

  Fly  2306 YAARDIEKHTMIIEYIGEVIRTEVSEIREK-QYESKNRGIYMFRLDE--------DRVVDATLSG 2361
            .....|.|...:.||.|||:  ..||::.: ..::.:...|:..|.|        :..||.|..|
  Rat   155 RTLEYIPKGRFVCEYAGEVL--GFSEVQRRIHLQTAHDPNYIIALREHTYNGQVMETFVDPTYIG 217

  Fly  2362 GLARYINHSCNPNCVTEIVEVDRDV-RIIIFAKRKIYRGEELSYDY------------KFDIEDE 2413
            .:.|::||||.||.:...|.:|..| ::.:||.:.|..||||||||            |..|:..
  Rat   218 NIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDILPGEELSYDYSGRFLNQISSKDKERIDCG 282

  Fly  2414 SHKIPCACGAPNCRKWM 2430
            ..:.||.|||.:|..::
  Rat   283 QPRKPCYCGAQSCATFL 299

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
trrNP_726773.2 PHA03255 184..>320 CDD:165513
PRK13914 <623..>851 CDD:237555
ePHD2_KMT2C_like 1898..2002 CDD:277136
FYRN 2067..2118 CDD:461787