DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trr and Su(var)3-9

DIOPT Version :9

Sequence 1:NP_726773.2 Gene:trr / 31149 FlyBaseID:FBgn0023518 Length:2431 Species:Drosophila melanogaster
Sequence 2:NP_524357.2 Gene:Su(var)3-9 / 41483 FlyBaseID:FBgn0263755 Length:635 Species:Drosophila melanogaster


Alignment Length:146 Identity:53/146 - (36%)
Similarity:76/146 - (52%) Gaps:21/146 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  2302 GLGLYAARDIEKHTMIIEYIGEVIRTEVSEIREKQYESKNRGIYMFRL------DEDRVVDATLS 2360
            |.|:.||..:.|...:.|||||:|.::.:..|.|.|:...| .|:|.|      |.:..:||...
  Fly   489 GWGVRAATALRKGEFVCEYIGEIITSDEANERGKAYDDNGR-TYLFDLDYNTAQDSEYTIDAANY 552

  Fly  2361 GGLARYINHSCNPN-----CVTEIVEVDRDVRIIIFAKRKIYRGEELSYDY-KFDIEDESH---- 2415
            |.::.:|||||:||     |..|.:.|... .::.|..|.|..|||||:|| :.|.||..:    
  Fly   553 GNISHFINHSCDPNLAVFPCWIEHLNVALP-HLVFFTLRPIKAGEELSFDYIRADNEDVPYENLS 616

  Fly  2416 ---KIPCACGAPNCRK 2428
               ::.|.|||.||||
  Fly   617 TAVRVECRCGADNCRK 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trrNP_726773.2 PHA03255 184..>320 CDD:165513
ePHD2_KMT2C_like 1898..2002 CDD:277136
FYRN 2068..2118 CDD:283589
FYRC 2126..2215 CDD:197781
SET <2266..2431 CDD:225491 53/146 (36%)
SET 2291..2413 CDD:214614 44/122 (36%)
PostSET 2415..2431 CDD:214703 8/21 (38%)
Su(var)3-9NP_524357.2 P-loop_NTPase 41..>80 CDD:304359
CHROMO 217..268 CDD:237991
PreSET 362..455 CDD:128744
SET 477..609 CDD:214614 43/121 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467611
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.