DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trr and CG4565

DIOPT Version :9

Sequence 1:NP_726773.2 Gene:trr / 31149 FlyBaseID:FBgn0023518 Length:2431 Species:Drosophila melanogaster
Sequence 2:NP_001097743.1 Gene:CG4565 / 41303 FlyBaseID:FBgn0037841 Length:269 Species:Drosophila melanogaster


Alignment Length:157 Identity:52/157 - (33%)
Similarity:78/157 - (49%) Gaps:20/157 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  2290 RNNVYLARSKIQG-LGLYAARDIEKHTMIIEYIGEVIRTEVSEIREKQYESKNRGI--YMFRLDE 2351
            |.::.:..|.:.| .||.....|.|...|.||.||::  .|.|.|.:.::::..|:  |:..|:|
  Fly   110 RKHLEIFDSPVYGSKGLRTTAKITKGGYICEYAGELL--TVPEARSRLHDNEKLGLMNYILVLNE 172

  Fly  2352 ---DR-----VVDATLSGGLARYINHSCNPNCVTEIVEVDRDV-RIIIFAKRKIYRGEELSYDYK 2407
               |:     :||.:..|.:.||:||||.|||....|.:|..: :|.|||.|.|...|||.:.| 
  Fly   173 YTSDKKQQVTIVDPSRRGNIGRYLNHSCEPNCHIAAVRIDCPIPKIGIFAARDIAAKEELCFHY- 236

  Fly  2408 FDIEDESHKI----PCACGAPNCRKWM 2430
             ..|.:..|:    .|.|||..|..:|
  Fly   237 -GGEGQYKKMTGGKTCLCGASKCTGFM 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trrNP_726773.2 PHA03255 184..>320 CDD:165513
ePHD2_KMT2C_like 1898..2002 CDD:277136
FYRN 2068..2118 CDD:283589
FYRC 2126..2215 CDD:197781
SET <2266..2431 CDD:225491 52/157 (33%)
SET 2291..2413 CDD:214614 44/133 (33%)
PostSET 2415..2431 CDD:214703 7/20 (35%)
CG4565NP_001097743.1 Pre-SET 10..103 CDD:282838
SET 111..239 CDD:214614 43/131 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467621
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.