DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trr and CG31111

DIOPT Version :9

Sequence 1:NP_726773.2 Gene:trr / 31149 FlyBaseID:FBgn0023518 Length:2431 Species:Drosophila melanogaster
Sequence 2:NP_733074.1 Gene:CG31111 / 318595 FlyBaseID:FBgn0051111 Length:269 Species:Drosophila melanogaster


Alignment Length:228 Identity:48/228 - (21%)
Similarity:98/228 - (42%) Gaps:18/228 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly  1983 CAIREECVFYKNKSVHCSVHGHAHAGI-TMGAGAGATTGAGLGGSVADNELSSLVVHRRVFVDRD 2046
            |.::.|....:::.::.......|.|: ...:|..:.:......:....:.|.:|.|:....|:.
  Fly    31 CRLQAELSVTRSQRLYLIERLMFHEGLEKSNSGRPSVSNGKNDAAETTKKYSPVVSHKNPVEDKP 95

  Fly  2047 ENRQVATVMHYSELSNLLRVGNMTFLNVGQLL---PHQLEAFHTPHYIYPIGYKVSRYYWCVRRP 2108
            :|   .|::...:....:.:.|:...::|:::   |:    |||..:|||:||..:|.|...:.|
  Fly    96 KN---VTIVRKKKPMFPMNLNNVLLHSLGEIISVNPN----FHTESWIYPVGYVATRIYAHPKDP 153

  Fly  2109 NRRCRYICSIAEAGCKPEFRIQVQDAGDKEPEREFRGSSPSAVWQQILQPITRLRKVHKWLQLFP 2173
            .::|.:.|.|......|:|:|    ..|.:.:..|.|.|.:....::|..|.|...|...:   |
  Fly   154 RKKCVFTCKILNNAGIPQFQI----IPDNDLDGVFFGESANMCHMELLNSIQRSPCVKIKI---P 211

  Fly  2174 QHISGEDLFGLTEPAIVRILESLPGIETLTDYR 2206
            ..:.||..|||:......:|...|.....|:::
  Fly   212 FDVQGEVFFGLSNQKTQSLLMMDPAFHQCTNFK 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trrNP_726773.2 PHA03255 184..>320 CDD:165513
ePHD2_KMT2C_like 1898..2002 CDD:277136 2/18 (11%)
FYRN 2068..2118 CDD:283589 16/52 (31%)
FYRC 2126..2215 CDD:197781 19/81 (23%)
SET <2266..2431 CDD:225491
SET 2291..2413 CDD:214614
PostSET 2415..2431 CDD:214703
CG31111NP_733074.1 FYRN 114..163 CDD:283589 16/52 (31%)
FYRC 171..246 CDD:197781 19/81 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4443
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.