Sequence 1: | NP_726773.2 | Gene: | trr / 31149 | FlyBaseID: | FBgn0023518 | Length: | 2431 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001009344.2 | Gene: | Tbrg1 / 300521 | RGDID: | 1305123 | Length: | 406 | Species: | Rattus norvegicus |
Alignment Length: | 273 | Identity: | 59/273 - (21%) |
---|---|---|---|
Similarity: | 109/273 - (39%) | Gaps: | 78/273 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 1986 REECVFYKNK--SVHCSVHGHAHA-------------GITMGA----GAGATTGAGLGGSVADNE 2031
Fly 2032 LSSLVVHRRVFVDRD---------ENRQVATVMHYSELSNL----------------------LR 2065
Fly 2066 VGNMTFLNVGQLLPHQLEAFHTPHYIYPIGYKVSRYYWCVRRPNRRCRYICSIAEAGCKPEFRIQ 2130
Fly 2131 VQDAGDKEPEREFRGSSPSAVWQQILQPITRLRKVHKWLQLFPQHIS-GEDLFGLTEPAIVRILE 2194
Fly 2195 SLPGIETLTDYRF 2207 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
trr | NP_726773.2 | PHA03255 | 184..>320 | CDD:165513 | |
ePHD2_KMT2C_like | 1898..2002 | CDD:277136 | 4/17 (24%) | ||
FYRN | 2068..2118 | CDD:283589 | 15/49 (31%) | ||
FYRC | 2126..2215 | CDD:197781 | 22/83 (27%) | ||
SET | <2266..2431 | CDD:225491 | |||
SET | 2291..2413 | CDD:214614 | |||
PostSET | 2415..2431 | CDD:214703 | |||
Tbrg1 | NP_001009344.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..26 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 116..144 | 9/44 (20%) | |||
FYRN | 183..233 | CDD:399155 | 16/50 (32%) | ||
FYRC | 239..320 | CDD:399156 | 23/85 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG4443 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |