DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trr and set2

DIOPT Version :9

Sequence 1:NP_726773.2 Gene:trr / 31149 FlyBaseID:FBgn0023518 Length:2431 Species:Drosophila melanogaster
Sequence 2:NP_594980.1 Gene:set2 / 2542070 PomBaseID:SPAC29B12.02c Length:798 Species:Schizosaccharomyces pombe


Alignment Length:179 Identity:65/179 - (36%)
Similarity:90/179 - (50%) Gaps:10/179 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly  2249 GSCSTQRMANSAAIAGEVACPYSKQFVHSKSSQYKKMKQEWRNNVYLARSKIQGLGLYAARDIEK 2313
            ||....||.:......:..|..|.|....:..::.|:      :|:|...|  |.||.|..::.|
pombe   146 GSNCINRMTSIECTDEDNVCGPSCQNQRFQRHEFAKV------DVFLTEKK--GFGLRADANLPK 202

  Fly  2314 HTMIIEYIGEVIRTEVSEIREKQYESKN-RGIYMFRLDEDRVVDATLSGGLARYINHSCNPNCVT 2377
            .|.:.|||||||..:....|.:||:|:. :..|...|.:...:|||..|.|||:.||||.|||..
pombe   203 DTFVYEYIGEVIPEQKFRKRMRQYDSEGIKHFYFMMLQKGEYIDATKRGSLARFCNHSCRPNCYV 267

  Fly  2378 EIVEVDRDVRIIIFAKRKIYRGEELSYDYKFDIEDESHKIPCACGAPNC 2426
            :...|...:|:.||.||.|.|||||::||..| ...:...||.||.|.|
pombe   268 DKWMVGDKLRMGIFCKRDIIRGEELTFDYNVD-RYGAQAQPCYCGEPCC 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trrNP_726773.2 PHA03255 184..>320 CDD:165513
ePHD2_KMT2C_like 1898..2002 CDD:277136
FYRN 2068..2118 CDD:283589
FYRC 2126..2215 CDD:197781
SET <2266..2431 CDD:225491 61/162 (38%)
SET 2291..2413 CDD:214614 51/122 (42%)
PostSET 2415..2431 CDD:214703 6/12 (50%)
set2NP_594980.1 AWS 125..179 CDD:197795 7/32 (22%)
SET 180..303 CDD:214614 52/131 (40%)
SET 275..791 CDD:225491 20/42 (48%)
PostSET 304..320 CDD:214703 6/12 (50%)
Med26 440..489 CDD:285873
SRI 699..771 CDD:285448
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4489
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.