DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trr and cti6

DIOPT Version :9

Sequence 1:NP_726773.2 Gene:trr / 31149 FlyBaseID:FBgn0023518 Length:2431 Species:Drosophila melanogaster
Sequence 2:NP_595212.1 Gene:cti6 / 2539769 PomBaseID:SPBC1685.08 Length:424 Species:Schizosaccharomyces pombe


Alignment Length:362 Identity:74/362 - (20%)
Similarity:134/362 - (37%) Gaps:87/362 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   697 PDVVKLEEVGSESK-AKLLVKQEAV----VKDSTGTPTSEERAEEIGTPEKRLNANATMTAINQ- 755
            |:..|:.:.|..:| :|.|...:.:    .::|:.||.|....:   :.::||..|:...|::. 
pombe   102 PEFHKVYQRGRGAKQSKYLGNGKPIEASQTEESSSTPPSPATKK---SSKQRLTMNSRDAALDYE 163

  Fly   756 -----VQNQSANQIQMATSTSTAS-NPSTPNPTVNATPMNNQRSAAEDNALLKQLLQNNSSSHSL 814
                 .:.:|....:....||:.| :|..|......|.:|.::...|:|   .::|:::..|...
pombe   164 EYLAIAKEKSLIPRRSRGRTSSKSLSPPAPQDESQGTEINLKQKIEEEN---DEILEDSKESKDE 225

  Fly   815 NQISITSAHVGSASASAPLSARKVINVRAPSMGKVRSLEDQLARPVIPPVPTATQAAGSSSSSGS 879
            |:            .:...|...|....||....|.::| ::|......|...:..|...||..|
pombe   226 NE------------ENKETSTTNVAETDAPEEETVDTVE-EIADEEKHSVKEESGEASPQSSQQS 277

  Fly   880 VATSTTTTTVASGGSSQQVATASATALPVSAVAITTPGVGGEAKLEQKSDQPAAIMQNQSQNQAP 944
            ..||.:|||.::..:.:                        ||..|.|:|.|||:        ||
pombe   278 TITSISTTTRSTRKAKR------------------------EAAAEDKADLPAAV--------AP 310

  Fly   945 PPPPPPQ------QQQQQQLHQPQQLQPSPHQVKQTVQIVSKETSFISGPVAAKTLVTEATSKPA 1003
            .|....:      :......|:..||.|.    ...|:.::|.....|     :..:||...:.|
pombe   311 KPSKTRKVGGRRGKSSSNDNHRIPQLHPD----GTFVETITKPKGLHS-----RITMTEMRRRVA 366

  Fly  1004 ELLPPPPY------EMATAPISNVTISISTKQAAPKE 1034
            .:|   .|      |||.....|.:.:.|:|:...:|
pombe   367 SML---EYIGHIQVEMAAQSAGNQSSTKSSKEGPEEE 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trrNP_726773.2 PHA03255 184..>320 CDD:165513
ePHD2_KMT2C_like 1898..2002 CDD:277136
FYRN 2068..2118 CDD:283589
FYRC 2126..2215 CDD:197781
SET <2266..2431 CDD:225491
SET 2291..2413 CDD:214614
PostSET 2415..2431 CDD:214703
cti6NP_595212.1 PHD_SF 50..100 CDD:304600
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4489
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.