DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trr and EZH1

DIOPT Version :9

Sequence 1:NP_726773.2 Gene:trr / 31149 FlyBaseID:FBgn0023518 Length:2431 Species:Drosophila melanogaster
Sequence 2:NP_001308008.1 Gene:EZH1 / 2145 HGNCID:3526 Length:753 Species:Homo sapiens


Alignment Length:533 Identity:113/533 - (21%)
Similarity:184/533 - (34%) Gaps:189/533 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly  2045 RDENRQVATVMHYSELSNLL-----------RVGNMTFLNVGQLLPHQ----------------- 2081
            :...:|....|.:|.::::.           |...:|.::....||.|                 
Human   231 KSSKKQFPNDMIFSAIASMFPENGVPDDMKERYRELTEMSDPNALPPQCTPNIDGPNAKSVQREQ 295

  Fly  2082 -LEAFHT--------------PHYIYPIGYK----------------------VSRYYWCVRRPN 2109
             |.:|||              |.:..|..||                      .::.|..:..|.
Human   296 SLHSFHTLFCRRCFKYDCFLHPFHATPNVYKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPR 360

  Fly  2110 RRC-------RYI----CSIAEAGCKPEFRIQVQDAGDKEPEREFRGSSPSAVWQQILQPITRLR 2163
            .:|       .:|    ||.|.|....|.:   :...|::...::..||..|  ....|..|:.:
Human   361 SKCSGRRRRRHHIVSASCSNASASAVAETK---EGDSDRDTGNDWASSSSEA--NSRCQTPTKQK 420

  Fly  2164 KVHKWLQLF-------PQHISG--EDLFGLTEP-------AIVRILESLPGIETLTD-YRFKYGR 2211
            ......||.       |...:|  |.||.:...       :|.|:|    |.:|... ::|....
Human   421 ASPAPPQLCVVEAPSEPVEWTGAEESLFRVFHGTYFNNFCSIARLL----GTKTCKQVFQFAVKE 481

  Fly  2212 NPLLEFPL--AINPSGAARTEPKQRQLLVW----RK----------------------------- 2241
            :.:|:.|.  .:|||     :.|:|:..:|    ||                             
Human   482 SLILKLPTDELMNPS-----QKKKRKHRLWAAHCRKIQLKKDNSSTQVYNYQPCDHPDRPCDSTC 541

  Fly  2242 ----------------PHTQRTAGSCSTQRMANSAAIAGEVACP--------------------- 2269
                            |..|.....|..:...|:.      .||                     
Human   542 PCIMTQNFCEKFCQCNPDCQNRFPGCRCKTQCNTK------QCPCYLAVRECDPDLCLTCGASEH 600

  Fly  2270 YSKQFVHSKSSQYKKMKQEWRNNVYLARSKIQGLGLYAARDIEKHTMIIEYIGEVIRTEVSEIRE 2334
            :..:.|..|:.   .:::..:.::.||.|.:.|.|.:....::|:..|.||.||:|..:.::.|.
Human   601 WDCKVVSCKNC---SIQRGLKKHLLLAPSDVAGWGTFIKESVQKNEFISEYCGELISQDEADRRG 662

  Fly  2335 KQYESKNRGIYMFRLDEDRVVDATLSGGLARYINHSCNPNCVTEIVEVDRDVRIIIFAKRKIYRG 2399
            |.|: |....::|.|:.|.|||||..|...|:.|||.||||..::|.|:.|.||.|||||.|..|
Human   663 KVYD-KYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVVMVNGDHRIGIFAKRAIQAG 726

  Fly  2400 EELSYDYKFDIED 2412
            |||.:||::...|
Human   727 EELFFDYRYSQAD 739

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trrNP_726773.2 PHA03255 184..>320 CDD:165513
ePHD2_KMT2C_like 1898..2002 CDD:277136
FYRN 2068..2118 CDD:283589 17/114 (15%)
FYRC 2126..2215 CDD:197781 20/105 (19%)
SET <2266..2431 CDD:225491 55/168 (33%)
SET 2291..2413 CDD:214614 51/122 (42%)
PostSET 2415..2431 CDD:214703
EZH1NP_001308008.1 EZH2_WD-Binding 45..73 CDD:288468
SANT 439..480 CDD:238096 10/44 (23%)
SANT 439..480 CDD:197842 10/44 (23%)
SET <469..733 CDD:225491 68/278 (24%)
SET 619..740 CDD:214614 51/122 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158026
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.