DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coa8 and COA8

DIOPT Version :9

Sequence 1:NP_001259147.1 Gene:Coa8 / 31148 FlyBaseID:FBgn0029594 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001357524.1 Gene:COA8 / 84334 HGNCID:20492 Length:193 Species:Homo sapiens


Alignment Length:177 Identity:63/177 - (35%)
Similarity:86/177 - (48%) Gaps:17/177 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FSLPRCYAAVQPGCPPPQEKPVVGLPHKPD------PKTVKC-DYIGPPDAQSNLRPYVRHYGDE 73
            |..|.|.|....||....|:........|.      |....| |:|||||..|||||...:..:.
Human    11 FLPPLCRAFACRGCQLAPERGAERRDTAPSGVSRFCPPRKSCHDWIGPPDKYSNLRPVHFYIPEN 75

  Fly    74 ETRLARSLRLKRIEVEAWNTDFWTKHNKRFYEEKEDFIR---------LHKESG-TSEVSADQMS 128
            |:.|.:.||..|.|.:.||..||...|..|.:|||:||.         |..||| .:.::|::|:
Human    76 ESPLEQKLRKLRQETQEWNQQFWANQNLTFSKEKEEFIHSRLKTKGLGLRTESGQKATLNAEEMA 140

  Fly   129 HFYKAFLDKNWRIHIMYNISWYLKNFDILTLAAAVQLQRLLALAKRR 175
            .|||.||.||::.|:.||..||.:||.|......|.|:|:....|::
Human   141 DFYKEFLSKNFQKHMYYNRDWYKRNFAITFFMGKVALERIWNKLKQK 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coa8NP_001259147.1 DUF2315 52..169 CDD:370902 52/126 (41%)
COA8NP_001357524.1 DUF2315 54..181 CDD:370902 52/126 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151491
Domainoid 1 1.000 98 1.000 Domainoid score I7221
eggNOG 1 0.900 - - E1_KOG4094
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I5008
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1410150at2759
OrthoFinder 1 1.000 - - FOG0009713
OrthoInspector 1 1.000 - - oto91495
orthoMCL 1 0.900 - - OOG6_107150
Panther 1 1.100 - - LDO PTHR31107
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2400
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.