DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coa8 and Coa8

DIOPT Version :9

Sequence 1:NP_001259147.1 Gene:Coa8 / 31148 FlyBaseID:FBgn0029594 Length:176 Species:Drosophila melanogaster
Sequence 2:XP_006516241.1 Gene:Coa8 / 68020 MGIID:1915270 Length:197 Species:Mus musculus


Alignment Length:129 Identity:51/129 - (39%)
Similarity:66/129 - (51%) Gaps:27/129 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CPPPQEKPVVGLPHKPDPKTVKC-DYIGPPDAQSNLRPYVRHYGDEETRLARSLRLKRIEVEAWN 92
            |||.|                .| |:|||||..|||||...|..:.|:.|.:.||..|.|.:.||
Mouse    47 CPPRQ----------------SCHDWIGPPDKCSNLRPVHFHIPENESPLEQRLRELRQETQEWN 95

  Fly    93 TDFWTKHNKRFYEEKEDFI---------RLHKESG-TSEVSADQMSHFYKAFLDKNWRIHIMYN 146
            ..||.|.|..|.:|||:||         .|..||| .:.:.|::|:.|||.||.||::.|:.||
Mouse    96 QQFWAKQNLSFNKEKEEFIYSRLQAKGAGLRTESGQRATLDAEEMADFYKDFLSKNFQKHMRYN 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coa8NP_001259147.1 DUF2315 52..169 CDD:370902 46/105 (44%)
Coa8XP_006516241.1 DUF2315 55..160 CDD:370902 44/115 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841621
Domainoid 1 1.000 99 1.000 Domainoid score I7122
eggNOG 1 0.900 - - E1_KOG4094
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I4996
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009713
OrthoInspector 1 1.000 - - oto95079
orthoMCL 1 0.900 - - OOG6_107150
Panther 1 1.100 - - LDO PTHR31107
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2400
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.780

Return to query results.
Submit another query.