DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coa8 and Coa8

DIOPT Version :9

Sequence 1:NP_001259147.1 Gene:Coa8 / 31148 FlyBaseID:FBgn0029594 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001032858.1 Gene:Coa8 / 299341 RGDID:1304719 Length:193 Species:Rattus norvegicus


Alignment Length:158 Identity:61/158 - (38%)
Similarity:82/158 - (51%) Gaps:27/158 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CPPPQEKPVVGLPHKPDPKTVKC-DYIGPPDAQSNLRPYVRHYGDEETRLARSLRLKRIEVEAWN 92
            |||.|                .| |:|||||..|||||...|..:.|:.|.:.||..|.|.:.||
  Rat    46 CPPRQ----------------SCHDWIGPPDKYSNLRPVHFHVPENESPLEQRLRELRQETQEWN 94

  Fly    93 TDFWTKHNKRFYEEKEDFI--RL-------HKESG-TSEVSADQMSHFYKAFLDKNWRIHIMYNI 147
            ..||.|.|..|.:|||:||  ||       ..||| .:.:.|::|:.|||.||.||::.|:.||.
  Rat    95 QQFWAKQNLSFNKEKEEFIYSRLQAKGSGPRTESGQRATLDAEEMADFYKDFLSKNFQKHMCYNR 159

  Fly   148 SWYLKNFDILTLAAAVQLQRLLALAKRR 175
            .||.:||.|......|.|:|:.:..|::
  Rat   160 DWYKRNFAITFFMGKVALERMWSKLKQK 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coa8NP_001259147.1 DUF2315 52..169 CDD:370902 55/126 (44%)
Coa8NP_001032858.1 DUF2315 54..181 CDD:370902 53/137 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344982
Domainoid 1 1.000 99 1.000 Domainoid score I6966
eggNOG 1 0.900 - - E1_KOG4094
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I4906
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1410150at2759
OrthoFinder 1 1.000 - - FOG0009713
OrthoInspector 1 1.000 - - oto98573
orthoMCL 1 0.900 - - OOG6_107150
Panther 1 1.100 - - LDO PTHR31107
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.