DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14818 and NSE5

DIOPT Version :9

Sequence 1:NP_001259146.1 Gene:CG14818 / 31147 FlyBaseID:FBgn0026088 Length:96 Species:Drosophila melanogaster
Sequence 2:NP_013689.1 Gene:NSE5 / 854985 SGDID:S000004485 Length:556 Species:Saccharomyces cerevisiae


Alignment Length:62 Identity:15/62 - (24%)
Similarity:27/62 - (43%) Gaps:2/62 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SSGDSGNTNVQEADLQ-EMEDVNNSLDALSCALDAVEQRTDDIMSQLREL-LNSNREIRRLI 70
            :..:||.|..|.|.:. |::......:.....:..:|||...:.::|..| ||...|...:|
Yeast   157 TKSESGVTYRQNASVDPELDQAKTFKNPYRSYISCLEQRNTILGNRLLNLKLNEPGEFINMI 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14818NP_001259146.1 UPF0184 1..83 CDD:112485 15/62 (24%)
NSE5NP_013689.1 Nse5 1..517 CDD:370066 15/62 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.845196 Normalized mean entropy S242
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.