DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14818 and BBLN

DIOPT Version :9

Sequence 1:NP_001259146.1 Gene:CG14818 / 31147 FlyBaseID:FBgn0026088 Length:96 Species:Drosophila melanogaster
Sequence 2:XP_011517306.1 Gene:BBLN / 79095 HGNCID:17823 Length:110 Species:Homo sapiens


Alignment Length:123 Identity:29/123 - (23%)
Similarity:49/123 - (39%) Gaps:41/123 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSPKNNHDPSSSGDSG----------------------------NTNVQEADLQEMEDVNNSLDA 37
            ||||.:.:.....|.|                            .....|| .:|...:|:.||.
Human     1 MSPKRSAEDQEGPDPGVGVLGPLHWGAGREAKRKETLRDSQRGCEEEYPEA-TREYAAINSMLDQ 64

  Fly    38 LSCALDAVEQRTDDIMSQLRELLNSNREIRRLIAEENDNAPESGDDNMDGQAGSEAAP 95
            ::..||.:|::.|.:.::|:|||.|||:.|....::.            |:|.|:|:|
Human    65 INSCLDHLEEKNDHLHARLQELLESNRQTRLEFQQQL------------GEAPSDASP 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14818NP_001259146.1 UPF0184 1..83 CDD:112485 24/109 (22%)
BBLNXP_011517306.1 UPF0184 39..110 CDD:112485 22/83 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005368
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_110120
Panther 1 1.100 - - LDO PTHR34344
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.