DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14817 and Mrpl57

DIOPT Version :9

Sequence 1:NP_001284796.1 Gene:CG14817 / 31145 FlyBaseID:FBgn0026089 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_080677.1 Gene:Mrpl57 / 67840 MGIID:1915090 Length:102 Species:Mus musculus


Alignment Length:107 Identity:34/107 - (31%)
Similarity:51/107 - (47%) Gaps:8/107 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHLTLINLFKKTVPGHIFRGKRRLVKPVSQRAMDTLTHEYERQEQVMLLLRHPYLTMEQSFGHAK 65
            |.||.: |.:..:||..:.||.|..:.||.:|.:::....|.:.:....|..||:|.||..|||.
Mouse     1 MFLTAV-LLRGRIPGRQWIGKHRRPRTVSFQAKESMIRRLEVEAENHYWLSMPYMTAEQECGHAA 64

  Fly    66 E--LQKREKLVARWTDEQTLRKMKPHVTIEERLNQLKIKEAW 105
            |  .|..|.:.|..|.     |...|..|.::|:.|.|.:.|
Mouse    65 ERRAQAFEAIKAAATS-----KFPKHRYIADQLDHLNISKKW 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14817NP_001284796.1 MRP-63 15..105 CDD:291639 28/91 (31%)
Mrpl57NP_080677.1 MRP-63 14..101 CDD:405643 28/91 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CQ5Y
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I5491
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto93549
orthoMCL 1 0.900 - - OOG6_109688
Panther 1 1.100 - - LDO PTHR14520
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.820

Return to query results.
Submit another query.