DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14817 and mrpl57

DIOPT Version :9

Sequence 1:NP_001284796.1 Gene:CG14817 / 31145 FlyBaseID:FBgn0026089 Length:106 Species:Drosophila melanogaster
Sequence 2:XP_002934730.3 Gene:mrpl57 / 100491945 XenbaseID:XB-GENE-972216 Length:104 Species:Xenopus tropicalis


Alignment Length:105 Identity:31/105 - (29%)
Similarity:52/105 - (49%) Gaps:4/105 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHLTLINLFKKTVPGHIFRGKRRLVKPVSQRAMDTLTHEYERQEQVMLLLRHPYLTMEQSFGHAK 65
            |.||.| ||:|.:||..:.||.|..:||:.:....:....|.:.:....:..||:|.||.:|||.
 Frog     1 MFLTNI-LFRKGIPGRQWIGKYRRPRPVTWQMKRNMIERLEVEAETEYWISRPYMTKEQEYGHAA 64

  Fly    66 ELQKREKLVARWTDEQTLRKMKPHVTIEERLNQLKIKEAW 105
            ..:.:|..|.|   :..:.....|..:::.||.|.:.:.|
 Frog    65 GRRLKEWEVIR---DSRVANFPSHRFLQDHLNHLNVTKKW 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14817NP_001284796.1 MRP-63 15..105 CDD:291639 22/89 (25%)
mrpl57XP_002934730.3 MRP-63 14..101 CDD:405643 22/89 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12177
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I5268
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1622855at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto103781
Panther 1 1.100 - - LDO PTHR14520
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.