DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps26 and VPS26B

DIOPT Version :9

Sequence 1:NP_569952.2 Gene:Vps26 / 31144 FlyBaseID:FBgn0014411 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_194499.2 Gene:VPS26B / 828883 AraportID:AT4G27690 Length:303 Species:Arabidopsis thaliana


Alignment Length:299 Identity:165/299 - (55%)
Similarity:219/299 - (73%) Gaps:9/299 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFL--GFGQSADIEIVF-DGAEHKTAEVKGEDGKVEKMLLFYDGETVSGKVNVTLKKP--GSKL 60
            ||:|  .|..:.:|.|.| ||...|...:|.|:|:...:.||:..:|:||||.:   :|  |.|:
plant     1 MNYLLGAFKPACNISITFSDGKNRKQVPMKKENGQTALVPLFHSQDTISGKVCI---EPYQGKKV 62

  Fly    61 EHQGIKIEFIGQIELYYDRGNHHEFKCLAKALARPGDLIQNNSYPFDFPKVEKQFEVYAGSNVRL 125
            ||.|:|:|.:||||:|:||||.::|..|.:.|..||::.:..:|||:||.||..:|.|.|.||||
plant    63 EHNGVKVELLGQIEMYFDRGNFYDFTSLVRELDVPGEIYERKTYPFEFPTVEMPYETYNGVNVRL 127

  Fly   126 RYFLRATIVRRIS-DITKEVDIAVHTLCSYPEMNNPIKMEVGIEDCLHIEFEYNKSKYHLRDTII 189
            ||.|:.|:.|..: .|.:..::.|......|::||.||||||||||||||||||||||||:|.|:
plant   128 RYVLKVTVTRGYAGSILEYQELVVRNYAPLPDINNSIKMEVGIEDCLHIEFEYNKSKYHLKDVIL 192

  Fly   190 GKIYFLLVRIKIKHMEIAIIKKESTGTGPTMFNENETIAKYEIMDGAPVKGESIPIRVFLAGYNL 254
            |||||||||||:|:|::.|.::||||.|.....|.||:||:|:|||.||:|||||:|:|||.|:|
plant   193 GKIYFLLVRIKMKNMDLEIRRRESTGAGANTHVETETLAKFELMDGTPVRGESIPVRLFLAPYDL 257

  Fly   255 TPTMRDINKKFSVKYFLNLVLMDTEDRRYFKQQEITLWR 293
            |||.|:||.||||||:|||||:|.|||||||||||||:|
plant   258 TPTHRNINNKFSVKYYLNLVLVDEEDRRYFKQQEITLYR 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps26NP_569952.2 Vps26 6..280 CDD:146336 148/277 (53%)
VPS26BNP_194499.2 Vps26 8..283 CDD:367592 148/277 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 304 1.000 Domainoid score I330
eggNOG 1 0.900 - - E1_KOG3063
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 329 1.000 Inparanoid score I680
OMA 1 1.010 - - QHG53681
OrthoDB 1 1.010 - - D987411at2759
OrthoFinder 1 1.000 - - FOG0001850
OrthoInspector 1 1.000 - - otm3189
orthoMCL 1 0.900 - - OOG6_101403
Panther 1 1.100 - - O PTHR12233
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1209
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.