DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps26 and vps26a

DIOPT Version :9

Sequence 1:NP_569952.2 Gene:Vps26 / 31144 FlyBaseID:FBgn0014411 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_001017171.1 Gene:vps26a / 549925 XenbaseID:XB-GENE-944860 Length:326 Species:Xenopus tropicalis


Alignment Length:320 Identity:207/320 - (64%)
Similarity:257/320 - (80%) Gaps:10/320 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFLG--FGQSADIEIVFDGAE-HKTAEVKGEDGKVEKMLLFYDGETVSGKVNVTLKKPGSKLEH 62
            |:||.  ||...:||:|.:.|: .|.:|:|.|:|||||..||||||:|:||||:..::||.:|||
 Frog     1 MSFLSGFFGPICEIEVVLNDADTRKVSEIKTEEGKVEKHFLFYDGESVAGKVNIVFRQPGKRLEH 65

  Fly    63 QGIKIEFIGQIELYYDRGNHHEFKCLAKALARPGDLIQNNSYPFDFPKVEKQFEVYAGSNVRLRY 127
            |||:|||:|||||:.|:.|.|||..|.|.||.||:|.|:.:|.|:|.:|||.:|.|.|:||||||
 Frog    66 QGIRIEFVGQIELFNDKSNTHEFVNLVKELALPGELTQSRNYDFEFMQVEKPYESYIGANVRLRY 130

  Fly   128 FLRATIVRRISDITKEVDIAVHTLCSYPEMNNPIKMEVGIEDCLHIEFEYNKSKYHLRDTIIGKI 192
            ||:.|||||::|:.||.|:.||.|.:||::||.||||||||||||||||||||||||:|.|:|||
 Frog   131 FLKVTIVRRLTDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEYNKSKYHLKDVIVGKI 195

  Fly   193 YFLLVRIKIKHMEIAIIKKESTGTGPTMFNENETIAKYEIMDGAPVKGESIPIRVFLAGYNLTPT 257
            |||||||||:|||:.:||||.||.||:...|.||:|||||||||||||||||||:|||||:.|||
 Frog   196 YFLLVRIKIQHMELQLIKKEITGIGPSTTTETETVAKYEIMDGAPVKGESIPIRLFLAGYDPTPT 260

  Fly   258 MRDINKKFSVKYFLNLVLMDTEDRRYFKQQEITLWRKA-----DKPRYHGAQQHQQQQHQ 312
            |||:||||||:|||||||:|.|||||||||||.|||||     .:..:|  |:.:.|:.|
 Frog   261 MRDVNKKFSVRYFLNLVLVDEEDRRYFKQQEIILWRKAPEKIRKRTNFH--QRFEPQEPQ 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps26NP_569952.2 Vps26 6..280 CDD:146336 184/274 (67%)
vps26aNP_001017171.1 Vps26 8..283 CDD:367592 184/274 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53681
OrthoDB 1 1.010 - - D342422at33208
OrthoFinder 1 1.000 - - FOG0001850
OrthoInspector 1 1.000 - - otm48530
Panther 1 1.100 - - O PTHR12233
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1646
SonicParanoid 1 1.000 - - X1209
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.060

Return to query results.
Submit another query.