DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps26 and vps26b

DIOPT Version :9

Sequence 1:NP_569952.2 Gene:Vps26 / 31144 FlyBaseID:FBgn0014411 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_001016540.1 Gene:vps26b / 549294 XenbaseID:XB-GENE-945593 Length:337 Species:Xenopus tropicalis


Alignment Length:336 Identity:225/336 - (66%)
Similarity:267/336 - (79%) Gaps:13/336 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFLGFGQSADIEIVF-DGAEHKTAEVKGEDGKVEKMLLFYDGETVSGKVNVTLKKPGSKLEHQG 64
            |:|.|||.:|:::|.. ||...:..|.|.||||.||..||||||||||:|.|.|:.||.:|||||
 Frog     1 MSFFGFGPAAELDIALTDGESRRRVEHKTEDGKKEKYFLFYDGETVSGRVTVNLRNPGKRLEHQG 65

  Fly    65 IKIEFIGQIELYYDRGNHHEFKCLAKALARPGDLIQNNSYPFDFPKVEKQFEVYAGSNVRLRYFL 129
            :||||||||||||||||||||..|.|.|||||::.|:.|:.|:|..|||.:|.|.|.||:|||||
 Frog    66 LKIEFIGQIELYYDRGNHHEFVSLVKDLARPGEISQSQSFDFEFTHVEKPYESYTGQNVKLRYFL 130

  Fly   130 RATIVRRISDITKEVDIAVHTLCSYPEMNNPIKMEVGIEDCLHIEFEYNKSKYHLRDTIIGKIYF 194
            |||:.||::|:.||:||.||||.:|||:|:.||||||||||||||||||||||||:|.|:|||||
 Frog   131 RATLSRRLNDVVKEMDIVVHTLSTYPELNSSIKMEVGIEDCLHIEFEYNKSKYHLKDVIVGKIYF 195

  Fly   195 LLVRIKIKHMEIAIIKKESTGTGPTMFNENETIAKYEIMDGAPVKGESIPIRVFLAGYNLTPTMR 259
            ||||||||||||.|||:|:|||||.:::||:|||||||||||||:|||||||:|||||.||||||
 Frog   196 LLVRIKIKHMEIDIIKRETTGTGPNVYHENDTIAKYEIMDGAPVRGESIPIRLFLAGYELTPTMR 260

  Fly   260 DINKKFSVKYFLNLVLMDTEDRRYFKQQEITLWRKAD---KPRYHGA----QQHQQQQHQHVPLH 317
            ||||||||:|:|||||:|.|:||||||||:.||||.|   |...|.|    |:.:...|   |..
 Frog   261 DINKKFSVRYYLNLVLIDEEERRYFKQQEVVLWRKGDIVRKSMSHQAAIASQRFEGTSH---PET 322

  Fly   318 APPHLVSGPAA 328
            .|.|  ||.||
 Frog   323 RPQH--SGAAA 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps26NP_569952.2 Vps26 6..280 CDD:146336 196/274 (72%)
vps26bNP_001016540.1 Vps26 6..281 CDD:367592 196/274 (72%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 311..337 9/26 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 413 1.000 Domainoid score I668
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3601
Inparanoid 1 1.050 451 1.000 Inparanoid score I1570
OMA 1 1.010 - - QHG53681
OrthoDB 1 1.010 - - D342422at33208
OrthoFinder 1 1.000 - - FOG0001850
OrthoInspector 1 1.000 - - otm48530
Panther 1 1.100 - - LDO PTHR12233
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1646
SonicParanoid 1 1.000 - - X1209
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.