DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps26 and vps26bl

DIOPT Version :9

Sequence 1:NP_569952.2 Gene:Vps26 / 31144 FlyBaseID:FBgn0014411 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_001002415.1 Gene:vps26bl / 436688 ZFINID:ZDB-GENE-040718-112 Length:329 Species:Danio rerio


Alignment Length:308 Identity:224/308 - (72%)
Similarity:262/308 - (85%) Gaps:3/308 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFLGFGQSADIEIVFDGAE-HKTAEVKGEDGKVEKMLLFYDGETVSGKVNVTLKKPGSKLEHQG 64
            |:|..|||||:|:||.:.|| .|.||.|.||||.:|..|||||||||||||||||.||.:|||||
Zfish     1 MSFFSFGQSAEIDIVLNDAETRKKAEHKTEDGKKDKYFLFYDGETVSGKVNVTLKTPGKRLEHQG 65

  Fly    65 IKIEFIGQIELYYDRGNHHEFKCLAKALARPGDLIQNNSYPFDFPKVEKQFEVYAGSNVRLRYFL 129
            .||||||||||||||||||||..|.|.|||||::.|:.::.|:|..|||.:|.|.|.||:|||||
Zfish    66 FKIEFIGQIELYYDRGNHHEFVSLVKDLARPGEMAQSQTFDFEFTHVEKPYESYTGQNVKLRYFL 130

  Fly   130 RATIVRRISDITKEVDIAVHTLCSYPEMNNPIKMEVGIEDCLHIEFEYNKSKYHLRDTIIGKIYF 194
            |||:.||::||.||:||.||||.:|||:|:.||||||||||||||||||||||||:|.|:|||||
Zfish   131 RATVSRRLNDICKEMDIVVHTLSTYPELNSSIKMEVGIEDCLHIEFEYNKSKYHLKDVIVGKIYF 195

  Fly   195 LLVRIKIKHMEIAIIKKESTGTGPTMFNENETIAKYEIMDGAPVKGESIPIRVFLAGYNLTPTMR 259
            ||||||||||||.|||:|:|||||.:::||:|||||||||||||:|||||||:|||||.:|||||
Zfish   196 LLVRIKIKHMEIDIIKRETTGTGPNVYHENDTIAKYEIMDGAPVRGESIPIRLFLAGYEMTPTMR 260

  Fly   260 DINKKFSVKYFLNLVLMDTEDRRYFKQQEITLWRKADKPRYHGAQQHQ 307
            ||||||||:|:|||||:|.|:|||||||||||||:.|..|  .:..||
Zfish   261 DINKKFSVRYYLNLVLIDEEERRYFKQQEITLWREGDVAR--KSMSHQ 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps26NP_569952.2 Vps26 6..280 CDD:146336 204/274 (74%)
vps26blNP_001002415.1 Vps26 6..281 CDD:146336 204/274 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 425 1.000 Domainoid score I598
eggNOG 1 0.900 - - E1_KOG3063
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 465 1.000 Inparanoid score I1516
OMA 1 1.010 - - QHG53681
OrthoDB 1 1.010 - - D342422at33208
OrthoFinder 1 1.000 - - FOG0001850
OrthoInspector 1 1.000 - - otm24999
orthoMCL 1 0.900 - - OOG6_101403
Panther 1 1.100 - - LDO PTHR12233
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1209
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.880

Return to query results.
Submit another query.