DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps26 and CG4074

DIOPT Version :9

Sequence 1:NP_569952.2 Gene:Vps26 / 31144 FlyBaseID:FBgn0014411 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_001287131.2 Gene:CG4074 / 40290 FlyBaseID:FBgn0037017 Length:316 Species:Drosophila melanogaster


Alignment Length:294 Identity:61/294 - (20%)
Similarity:118/294 - (40%) Gaps:53/294 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EDGKVEKMLLFYDGETVSGKVNVTLKKPGSKLEHQGIKIEFIGQIELYYDRGNHHEFKCLAKALA 93
            ::.|.|.::|:     :.|.||:.|            ..:.:|..:.:|:..........:..|:
  Fly    33 QETKHEGIILY-----LEGIVNLQL------------SAKTVGLFDAFYNSVKPINLLQNSLELS 80

  Fly    94 RPGDLIQNNS-YPFDFPKVEKQ-----FEVYAGSNVRLRYFLRATIVRR---------------- 136
            .||.|....| :.|:.|.|.|:     :|.|.|..:.:.|.|..|:.|.                
  Fly    81 APGKLSAGRSEFHFELPLVCKKEPRILYETYHGVFINVNYQLTCTVKRNFLGKATTKIQQFCVQY 145

  Fly   137 ----ISDITKEV---DIAVHTLCSYPEMNNPIKMEVGIEDCLHIEFEYNKSKYHLRDTIIGKIYF 194
                :|:.:|:|   .::..:|    :.|...|..:.:...| |....::|::.:...|.|.|..
  Fly   146 KPVPLSEDSKKVVPFSLSPDSL----QKNASAKERLSMPRFL-ITGRLDRSEFCVTTPITGSITV 205

  Fly   195 LLVRIKIKHMEIAIIKKESTGTGPTMFNENETIAKYEIMDGAPVKGESIPIRVFLAGYNLTPTMR 259
            ......||.:|:.:::.|:.|.......:...|...:|.||..:....:||.:.|......||: 
  Fly   206 QHTEAAIKSIEMQLVRVETCGCDEGYSKDATEIQTIQIADGNVLPKLELPIHMVLPRLFTCPTL- 269

  Fly   260 DINKKFSVKYFLNLVLMDTEDRRYFKQQEITLWR 293
             :.|.|.:::.|||:::..||....:..:|.|.|
  Fly   270 -LTKNFKIEFELNLIVVFKEDYTVSENFKIVLKR 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps26NP_569952.2 Vps26 6..280 CDD:146336 56/279 (20%)
CG4074NP_001287131.2 Arrestin_N 6..289 CDD:419887 56/279 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449912
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12233
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.