DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgam5 and AT5G04120

DIOPT Version :9

Sequence 1:NP_569951.1 Gene:Pgam5 / 31143 FlyBaseID:FBgn0023517 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_196032.1 Gene:AT5G04120 / 830290 AraportID:AT5G04120 Length:238 Species:Arabidopsis thaliana


Alignment Length:244 Identity:64/244 - (26%)
Similarity:99/244 - (40%) Gaps:64/244 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 EEENRYNAELEKAKAKKARHIILVRHGE--YLDVG------DSDDTHHLTERGRKQAEFTGKRLC 125
            |.|.:::.:::  ...:...|:||||||  :...|      :||    |.|.|.|||....:||.
plant     9 EREFKWSEDVK--VESEVTEIVLVRHGETTWNAAGRIQGQIESD----LNEVGLKQAVAIAERLG 67

  Fly   126 ELGIKWDKVVA---STMVRAQETSDIILKQIDFEKEKVVNCAFLREGAPIP--PQPPVG-----H 180
                |.::.||   |.:.||::|:.:|.|          .| |..|...:|  .:..||     :
plant    68 ----KEERPVAVYSSDLKRAKDTALMIAK----------TC-FCPEVIEVPDLKERHVGSLQGLY 117

  Fly   181 WK------PEA-SQFLRDGSRIE-----AGFRRYFHRAYPDQE------KESYTLIVGHGNVIRY 227
            ||      ||| |.|....:.:|     ..|.:...|:....|      |....::|.||.|:|.
plant   118 WKEGAEKEPEAYSAFFSSQNDLEIPGGGESFDQLADRSMDALEQIAKKHKGERVIVVTHGGVLRA 182

  Fly   228 FVCRALQFPAEGWL---RININH-ASITWLTISPSGNVSIKYLGDSGFM 272
            ...|..|..:.|.|   .:|:.| ....|:..|.|   .:.:|...||:
plant   183 IYLRITQASSAGKLLNASVNVVHLRDQKWIIDSWS---DVSHLSSVGFL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgam5NP_569951.1 HP_PGM_like 88..265 CDD:132718 59/216 (27%)
AT5G04120NP_196032.1 His_Phos_1 27..219 CDD:395236 59/213 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1112626at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.