DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgam5 and AT3G50520

DIOPT Version :9

Sequence 1:NP_569951.1 Gene:Pgam5 / 31143 FlyBaseID:FBgn0023517 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_190621.1 Gene:AT3G50520 / 824216 AraportID:AT3G50520 Length:230 Species:Arabidopsis thaliana


Alignment Length:240 Identity:64/240 - (26%)
Similarity:103/240 - (42%) Gaps:59/240 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 EENRYNAE-LEKAKAKKARHIILVRHGE-----------YLDVGDSDDTHHLTERGRKQAEFTGK 122
            ||:|:::| ::.|:      |::|||||           :|||       .|.:.||:||:...:
plant     2 EESRFDSEDVDYAE------IVVVRHGETSWNAERKIQGHLDV-------ELNDAGRQQAQRVAE 53

  Fly   123 RLCELGIKWDKVVASTMVRAQETSDIILKQIDFEKEKVVNCAFLRE-------GAPIPPQPPVGH 180
            ||.: ..|...|.:|.:.||.||:.||..:..  |.:|:....|||       |........:  
plant    54 RLSK-EQKISHVYSSDLKRAFETAQIIAAKCG--KLEVLTDRDLRERHLGDMQGLVYQEASKI-- 113

  Fly   181 WKPEA-SQFLRDGSRIE-AGFRRYFHRAYP----------DQEKESYTLIVGHGNVIR--YFVCR 231
             :||| ..|..:.:.:: .|......:.|.          |:.|....::|.||.|||  |...|
plant   114 -RPEAYKAFSSNRTDVDIPGGGESLDKLYDRCTTALQRIGDKHKGERIVVVTHGGVIRSLYERAR 177

  Fly   232 ALQFPAEGWLRININHASI----TWLTISPSGNVSIKYLGDSGFM 272
            ......|..|..::|...:    .| ||...|:||  :|.::||:
plant   178 PSARKVEKILNTSVNVFRLFDGDKW-TIQVWGDVS--HLEETGFL 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgam5NP_569951.1 HP_PGM_like 88..265 CDD:132718 56/212 (26%)
AT3G50520NP_190621.1 His_Phos_1 16..210 CDD:395236 54/207 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1112626at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.