DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgam5 and Pgam5

DIOPT Version :9

Sequence 1:NP_569951.1 Gene:Pgam5 / 31143 FlyBaseID:FBgn0023517 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001157010.1 Gene:Pgam5 / 72542 MGIID:1919792 Length:288 Species:Mus musculus


Alignment Length:282 Identity:129/282 - (45%)
Similarity:170/282 - (60%) Gaps:19/282 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CGTGAGLAAYYLQRL----------RDPQTVVQNSWT--HSDKPVDPWALWDTNWDCREPRALVR 61
            ||...|.||.....:          .|.:.....:||  .:.:.|     ||||||.|||.:|:.
Mouse    12 CGLAGGSAAVLFSAVAVGKPRGGGDADTRATEPPAWTGARAGRGV-----WDTNWDRREPLSLIN 71

  Fly    62 PLRNSQPEEENRYNAELEKAKAKKARHIILVRHGEYLDVGDSDDTHHLTERGRKQAEFTGKRLCE 126
            ..:.:....|:...:.|:..|||..|||.|:||.:|...|..:....||..||:|||.||.||..
Mouse    72 LKKRNVESGEDELTSRLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLAS 136

  Fly   127 LGIKWDKVVASTMVRAQETSDIILKQIDFEKEKVVNCAFLREGAPIPPQPPVGHWKPEASQFLRD 191
            ||:|::|:|.|:|.||.||:|||.|.:.....  |:...|||||||.|.|||.||||||.|:..|
Mouse   137 LGLKFNKIVHSSMTRAVETTDIISKHLPGVSR--VSTDLLREGAPIEPDPPVSHWKPEAVQYYED 199

  Fly   192 GSRIEAGFRRYFHRAYPDQEKESYTLIVGHGNVIRYFVCRALQFPAEGWLRININHASITWLTIS 256
            |:||||.||.|.|||...||::||.:.:.|.|||||.||||||||.|||||:::|:.|||.|.|.
Mouse   200 GARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIR 264

  Fly   257 PSGNVSIKYLGDSGFMPAELLT 278
            |:|.|:::.|||:||||.:.:|
Mouse   265 PNGRVALRTLGDTGFMPPDKIT 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgam5NP_569951.1 HP_PGM_like 88..265 CDD:132718 96/176 (55%)
Pgam5NP_001157010.1 Interaction with KEAP1. /evidence=ECO:0000250 76..81 0/4 (0%)
HP_PGM_like 98..271 CDD:132718 92/172 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833966
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4609
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H14597
Inparanoid 1 1.050 245 1.000 Inparanoid score I3271
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58579
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006616
OrthoInspector 1 1.000 - - oto93718
orthoMCL 1 0.900 - - OOG6_104882
Panther 1 1.100 - - LDO PTHR20935
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2720
SonicParanoid 1 1.000 - - X4856
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.