DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgam5 and Tigar

DIOPT Version :9

Sequence 1:NP_569951.1 Gene:Pgam5 / 31143 FlyBaseID:FBgn0023517 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001381980.1 Gene:Tigar / 502894 RGDID:1560038 Length:268 Species:Rattus norvegicus


Alignment Length:252 Identity:52/252 - (20%)
Similarity:84/252 - (33%) Gaps:97/252 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 IILVRHG------EYLDVGDSDDTHHLTERGRKQAEFTGKRLCELGIKWDKVVASTMVRAQET-- 145
            :.::|||      |.:..|...|. .|:|.|.:||..||:.|.  .:.:....:|.:.|.::|  
  Rat     6 LTIIRHGETRLNKEKIIQGQGVDA-PLSETGFRQAAATGQFLS--NVHFTHAFSSDLTRTKQTIH 67

  Fly   146 ---------SDIILKQIDFEKEKVVNCAFLREGAPIPP---------------QPPVGHWKPEAS 186
                     .||.:|.....:|::...|   ||.|:..               .||.|....:..
  Rat    68 GILEKSRFCKDIAVKYDSRLRERMYGVA---EGKPLSELRAMAKAAGEECPMFTPPGGETVEQVK 129

  Fly   187 QFLRD----------GSRIEAGFRRYFHRAYPDQEKES--------------------------- 214
            ...:|          |   :||.|..|....||...||                           
  Rat   130 MRGKDFFDFICQLILG---KAGQRENFLPGAPDNCLESSLAEVFPVGKHGSLGTDPKHGALGLTA 191

  Fly   215 YTLIVGHGNVIR----YFV----CRALQFPAEGWLRININHASITWLTISPSGNVSI 263
            ..|:|.||..:|    ||:    |   ..||      .|:...::  :|:|:..:|:
  Rat   192 SILVVSHGAYMRSLFGYFLSDLRC---SLPA------TIDKFELS--SITPNTGISV 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgam5NP_569951.1 HP_PGM_like 88..265 CDD:132718 52/252 (21%)
TigarNP_001381980.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1112626at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.