DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgam5 and Pgam5-2

DIOPT Version :9

Sequence 1:NP_569951.1 Gene:Pgam5 / 31143 FlyBaseID:FBgn0023517 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_611911.1 Gene:Pgam5-2 / 37899 FlyBaseID:FBgn0035004 Length:280 Species:Drosophila melanogaster


Alignment Length:295 Identity:131/295 - (44%)
Similarity:173/295 - (58%) Gaps:34/295 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RKLTSFVCGTGAGLAAYYLQRLRD---PQTVVQNSWTHSDKPVDPWA--LWDTNWDCREPRALVR 61
            |.:.:..||:   |..|:..||.|   |..:...:.....:.::|.|  .|..:||..:|:  ::
  Fly     8 RSVGAMSCGS---LVTYFAIRLFDGLEPSMLSGGAQGGKGRAIEPLASGAWRHHWDLDKPQ--LQ 67

  Fly    62 PLRNSQPEEENRYNAELEKAKAKKARHIILVRHGEYLDVGDSDDTHHLTERGRKQAEFTGKRLCE 126
            .:.|.:              ::...|||||||||||....:..   ||||.||:|||.||:||.|
  Fly    68 KVANGE--------------ESSALRHIILVRHGEYTRTPNGS---HLTELGRRQAERTGQRLRE 115

  Fly   127 LGIKWDKVVASTMVRAQETSDIILKQIDFEKEKVVNCAFLREGAPIPPQPPVGHWKPEASQ---- 187
            :|:.||.||||||.||:||:.|||||::.:..|:..|..|.||.|.|..||.   |..|..    
  Fly   116 MGLSWDHVVASTMPRAEETAMIILKQLNLDPLKMKRCTLLPEGTPYPGDPPS---KRSARSLDLA 177

  Fly   188 FLRDGSRIEAGFRRYFHRAYPDQEKESYTLIVGHGNVIRYFVCRALQFPAEGWLRININHASITW 252
            :.|||.||||.|||||.||.|:||.:||.|||||.|||||.:.||||.|...|.|:|:||.||||
  Fly   178 YQRDGPRIEAAFRRYFFRASPEQEHDSYLLIVGHSNVIRYLILRALQLPPAAWTRLNLNHGSITW 242

  Fly   253 LTISPSGNVSIKYLGDSGFMPAELLTNRIPRDVKN 287
            ||:.|||.|:::.||||||||...:|:|.|...|:
  Fly   243 LTVWPSGYVTLRCLGDSGFMPVTEITHRRPSPAKS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgam5NP_569951.1 HP_PGM_like 88..265 CDD:132718 102/180 (57%)
Pgam5-2NP_611911.1 HP_PGM_like 80..245 CDD:132718 97/170 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443729
Domainoid 1 1.000 66 1.000 Domainoid score I16948
eggNOG 1 0.900 - - E1_KOG4609
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 40 1.000 Inparanoid score I489
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1112626at2759
OrthoFinder 1 1.000 - - FOG0006616
OrthoInspector 1 1.000 - - otm14764
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20935
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2720
SonicParanoid 1 1.000 - - X4856
1110.930

Return to query results.
Submit another query.