DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgam5 and PGAM5

DIOPT Version :9

Sequence 1:NP_569951.1 Gene:Pgam5 / 31143 FlyBaseID:FBgn0023517 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001164014.1 Gene:PGAM5 / 192111 HGNCID:28763 Length:289 Species:Homo sapiens


Alignment Length:280 Identity:127/280 - (45%)
Similarity:171/280 - (61%) Gaps:14/280 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CGTGAGLAAYYLQRL----------RDPQTVVQNSWTHSDKPVDPWALWDTNWDCREPRALVRPL 63
            ||...|.||.....:          .:|:.....:|....:| .| .:||.|||.|||.:|:...
Human    12 CGLAGGSAAVLFSAVAVGKPRAGGDAEPRPAEPPAWAGGARP-GP-GVWDPNWDRREPLSLINVR 74

  Fly    64 RNSQPEEENRYNAELEKAKAKKARHIILVRHGEYLDVGDSDDTHHLTERGRKQAEFTGKRLCELG 128
            :.:....|....::|:..|||..|||.|:||.:|...|..:....||..||:|||.||.||..||
Human    75 KRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLG 139

  Fly   129 IKWDKVVASTMVRAQETSDIILKQIDFEKEKVVNCAFLREGAPIPPQPPVGHWKPEASQFLRDGS 193
            :|::|:|.|:|.||.||:|||.:.:....:  |:...|||||||.|.|||.||||||.|:..||:
Human   140 LKFNKIVHSSMTRAIETTDIISRHLPGVCK--VSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGA 202

  Fly   194 RIEAGFRRYFHRAYPDQEKESYTLIVGHGNVIRYFVCRALQFPAEGWLRININHASITWLTISPS 258
            ||||.||.|.|||...||::||.:.:.|.|||||.||||||||.|||||:::|:.|||.|.|.|:
Human   203 RIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPN 267

  Fly   259 GNVSIKYLGDSGFMPAELLT 278
            |.|:::.|||:||||.:.:|
Human   268 GRVALRTLGDTGFMPPDKIT 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgam5NP_569951.1 HP_PGM_like 88..265 CDD:132718 95/176 (54%)
PGAM5NP_001164014.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..59 4/28 (14%)
PTZ00122 <58..287 CDD:240279 117/230 (51%)
Interaction with KEAP1 77..82 0/4 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143737
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4609
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H14597
Inparanoid 1 1.050 242 1.000 Inparanoid score I3334
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58579
OrthoDB 1 1.010 - - D1112626at2759
OrthoFinder 1 1.000 - - FOG0006616
OrthoInspector 1 1.000 - - oto90141
orthoMCL 1 0.900 - - OOG6_104882
Panther 1 1.100 - - LDO PTHR20935
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2720
SonicParanoid 1 1.000 - - X4856
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.